BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000411-TA|BGIBMGA000411-PA|IPR013818|Lipase, N-terminal, IPR002197|Helix-turn-helix, Fis-type, IPR000734|Lipase (251 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 22 6.1 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 22 6.1 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 120 DCELKYYKPGEIETKMLAFQDAGNPPLYVIVEWKYE 155 +C K +I K++ F P ++V++E KY+ Sbjct: 74 ECSPCSEKQKKIADKVVQFLIDNKPEIWVLLEAKYD 109 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 120 DCELKYYKPGEIETKMLAFQDAGNPPLYVIVEWKYE 155 +C K +I K++ F P ++V++E KY+ Sbjct: 74 ECSPCSEKQKKIADKVVQFLIDNKPEIWVLLEAKYD 109 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.139 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,196 Number of Sequences: 429 Number of extensions: 3462 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 251 length of database: 140,377 effective HSP length: 56 effective length of query: 195 effective length of database: 116,353 effective search space: 22688835 effective search space used: 22688835 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -