BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000409-TA|BGIBMGA000409-PA|undefined (108 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Sc... 24 4.6 SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizo... 24 6.0 >SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Schizosaccharomyces pombe|chr 1|||Manual Length = 564 Score = 24.2 bits (50), Expect = 4.6 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Query: 33 SQFEPSPDPALERIAEEATDNPGMCKIY 60 S F PSP L R+A DN G K+Y Sbjct: 305 SSFNPSPLMTLSRLAAGEPDNNG--KVY 330 >SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 23.8 bits (49), Expect = 6.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Query: 37 PSPDPALERIAEEATDNPGMCKIYKQKSNGSFRWDIDQ 74 PS DP L I E T + ++YK K + D+ Q Sbjct: 690 PSKDPQLFTIEEAFTTVHHLVRLYKVKKPDTLGRDLKQ 727 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.130 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 539,081 Number of Sequences: 5004 Number of extensions: 20827 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 34 Number of HSP's gapped (non-prelim): 2 length of query: 108 length of database: 2,362,478 effective HSP length: 64 effective length of query: 44 effective length of database: 2,042,222 effective search space: 89857768 effective search space used: 89857768 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -