BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000406-TA|BGIBMGA000406-PA|IPR001452|Src homology-3 (294 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 24 5.9 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.9 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 234 WWQRPLGVRRDHCQRCGASSSKRPL 258 WW L R +H ++ +S S +P+ Sbjct: 157 WWSEYLDARPEHVRKYPSSYSGKPI 181 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 5.9 Identities = 16/66 (24%), Positives = 26/66 (39%) Query: 96 GERPLQVTHNLQVSDGDNGLMLLRDQIVIQVGDEVDGMVMIRSGDNRQGVCPIKFLQEKR 155 G++ Q + +S G +L + + D D + I SGD G + KR Sbjct: 990 GQKKRQKAMDEGLSQKQKGRILSKATVSTSESDSDDSRLKIASGDESGGESGAPATKRKR 1049 Query: 156 GSLTDE 161 +DE Sbjct: 1050 RIASDE 1055 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.135 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 310,216 Number of Sequences: 2123 Number of extensions: 12945 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 32 Number of HSP's gapped (non-prelim): 2 length of query: 294 length of database: 516,269 effective HSP length: 64 effective length of query: 230 effective length of database: 380,397 effective search space: 87491310 effective search space used: 87491310 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -