GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000401-TA|BGIBMGA000401-PA|IPR001320|Ionotropic
glutamate receptor, IPR001508|NMDA receptor
         (787 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript...    26   4.4  

>AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase
            protein.
          Length = 1168

 Score = 25.8 bits (54), Expect = 4.4
 Identities = 16/45 (35%), Positives = 20/45 (44%)

Query: 597  SPDTSHRSPRQGRSPRQLRSPKGRRKRCSLAGLNVRRFSTDSVLG 641
            SP      PR  R P   R+ + RR+R +   L  RR   D  LG
Sbjct: 1103 SPPVPPIPPRSRRLPPSPRTTEMRRRRRNYMQLQYRRRRRDGELG 1147


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.321    0.135    0.413 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 720,066
Number of Sequences: 2123
Number of extensions: 27648
Number of successful extensions: 65
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 64
Number of HSP's gapped (non-prelim): 1
length of query: 787
length of database: 516,269
effective HSP length: 69
effective length of query: 718
effective length of database: 369,782
effective search space: 265503476
effective search space used: 265503476
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 52 (25.0 bits)