BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000400-TA|BGIBMGA000400-PA|undefined (265 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 23 9.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.0 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 100 VVLICDIHYAKLVIDEAKRL 119 + ++ D+HY LVI E RL Sbjct: 52 IAMLNDMHYLDLVIKETLRL 71 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 63 TIANDMLPLEIRLEITARETLQALRRLAEISR 94 TI P ++ L + +QA RLAE++R Sbjct: 2528 TIREYRRPRDVLLSVVGEFIIQASTRLAELAR 2559 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.325 0.136 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,063 Number of Sequences: 2123 Number of extensions: 8448 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 30 Number of HSP's gapped (non-prelim): 2 length of query: 265 length of database: 516,269 effective HSP length: 63 effective length of query: 202 effective length of database: 382,520 effective search space: 77269040 effective search space used: 77269040 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -