BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000397-TA|BGIBMGA000397-PA|IPR001478|PDZ/DHR/GLGF (228 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48060.1 68418.m05938 C2 domain-containing protein contains I... 31 0.49 At5g46210.1 68418.m05686 cullin, putative similar to SP|Q13619 C... 31 0.49 At4g30100.1 68417.m04280 tRNA-splicing endonuclease positive eff... 31 0.49 At1g10130.1 68414.m01142 calcium-transporting ATPase 3, endoplas... 30 1.5 At5g55540.1 68418.m06919 expressed protein 29 2.0 At5g46390.2 68418.m05710 peptidase S41 family protein similar to... 29 2.6 At5g46390.1 68418.m05709 peptidase S41 family protein similar to... 29 2.6 At4g02400.1 68417.m00324 U3 ribonucleoprotein (Utp) family prote... 29 2.6 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 29 3.4 At3g12545.1 68416.m01561 lipid transfer protein-related low simi... 29 3.4 At4g08097.1 68417.m01316 hypothetical protein 28 4.5 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 4.5 At1g32490.1 68414.m04009 RNA helicase, putative similar to ATP-d... 28 4.5 At3g01510.1 68416.m00077 5'-AMP-activated protein kinase beta-1 ... 28 6.0 At1g17450.1 68414.m02137 ATP phosphoribosyltransferase -related ... 28 6.0 At4g10070.1 68417.m01647 KH domain-containing protein DNA-direct... 27 7.9 At3g25130.1 68416.m03138 expressed protein 27 7.9 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 27 7.9 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 27 7.9 At2g47010.2 68415.m05873 expressed protein 27 7.9 At2g47010.1 68415.m05872 expressed protein 27 7.9 At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family pr... 27 7.9 >At5g48060.1 68418.m05938 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1036 Score = 31.5 bits (68), Expect = 0.49 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 9/145 (6%) Query: 63 HIEVGDHIEK--LNGENMVGKRHYEVAKIL-KDIPKGTTFIMRLVEPLKSGFGSIGPKTG 119 HIEV + E+ + G + +G+ + I+ KD F + L S G IG K Sbjct: 71 HIEVSVYHERRPIPGRSFLGRVKISLCNIVYKDDQVYQRFTLEKKWLLSSVKGEIGLKFY 130 Query: 120 SGRSGKKQNFGSGKETLRFKANGQATIENEHDDKSKAGIEKINGLLESFMGINDSELASQ 179 S + Q F + + + QA+ +D + + E L+SF + +LA Sbjct: 131 ISSSEEDQTFPLPSKP--YTSPTQASASGTEEDTADSETEDS---LKSFASAEEEDLADS 185 Query: 180 MWDLAEGKQNSMELAEAIDNSDLQE 204 + + EGK+ S E+ E + QE Sbjct: 186 VSECVEGKK-SEEVKEPVQKLHRQE 209 >At5g46210.1 68418.m05686 cullin, putative similar to SP|Q13619 Cullin homolog 4A (CUL-4A) {Homo sapiens}; contains Pfam profile PF00888: Cullin family Length = 792 Score = 31.5 bits (68), Expect = 0.49 Identities = 29/98 (29%), Positives = 41/98 (41%), Gaps = 6/98 (6%) Query: 126 KQNFGSGKETLRFKANGQATIENEHDDKSKAGIEKINGLLESFMGINDSELASQMWDLAE 185 K +F GK+ L QA + +D K E I + I D EL + LA Sbjct: 612 KADFSKGKKELAVSLF-QAVVLMLFNDAMKLSFEDI----KDSTSIEDKELRRTLQSLAC 666 Query: 186 GKQNSMEL-AEAIDNSDLQEFGFTDEFIIELWGVITDA 222 GK ++ + D D EF F DEF L+ + +A Sbjct: 667 GKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNA 704 >At4g30100.1 68417.m04280 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 1311 Score = 31.5 bits (68), Expect = 0.49 Identities = 27/81 (33%), Positives = 34/81 (41%), Gaps = 10/81 (12%) Query: 85 EVAKILKD--IPKGTTFIMRLVEPLKSGFGSIGPKTGS------GRSGKKQNFGSGKETL 136 E+ + KD +PK +FI + P GF S GP+T S RSG T Sbjct: 1208 EMESLPKDFPVPKVPSFIPKA--PNARGFRSGGPRTRSIDMHPESRSGTPSEDDKKLSTT 1265 Query: 137 RFKANGQATIENEHDDKSKAG 157 F NG + EN DD G Sbjct: 1266 TFPRNGNSRRENSVDDSDPPG 1286 >At1g10130.1 68414.m01142 calcium-transporting ATPase 3, endoplasmic reticulum-type (ACA6) (ECA3) nearly identical to SP|Q9SY55 Calcium-transporting ATPase 3, endoplasmic reticulum-type (EC 3.6.3.8) {Arabidopsis thaliana); contains InterPro Accession IPR006069: Cation transporting ATPase Length = 998 Score = 29.9 bits (64), Expect = 1.5 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 10/64 (15%) Query: 98 TFIMRLVEPLKSGFGSIGPKTGSGRSGKKQNFGS-GKETLR-----FKA--NGQATI--E 147 + I R + L +G GS+ P T +GR+ + F S G ETLR FK +GQ TI + Sbjct: 516 SIIARCNKILCNGDGSVVPLTAAGRAELESRFYSFGDETLRCLALAFKTVPHGQQTISYD 575 Query: 148 NEHD 151 NE+D Sbjct: 576 NEND 579 >At5g55540.1 68418.m06919 expressed protein Length = 1380 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 164 LLESFMGINDSELASQMWDLAEGKQNSMELAEAID-NSDLQEFGFTD 209 LL S + +NDS Q+W+ + G + + EL+ I+ NS L+ F D Sbjct: 153 LLGSALQVNDSLEELQIWEDSIGSKGAEELSRMIEMNSSLKLFSIFD 199 >At5g46390.2 68418.m05710 peptidase S41 family protein similar to C-terminal peptidase of the D1 protein [Hordeum vulgare subsp vulgare] GI:1296805; contains Pfam profiles PF03572: Peptidase family S41B, PF00595: PDZ domain (Also known as DHR or GLGF) Length = 489 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query: 61 IPHIEVGDHIEKLNGENMVGKRHYEVAKILKDIPKGTTFIMRLVEPLKSG 110 I ++ GD I +NG ++ GK +EV+ +L+ K TF++ V+ K G Sbjct: 229 IAGVKQGDEILAVNGMDVSGKSSFEVSSLLQGPSK--TFVVLKVKHGKCG 276 >At5g46390.1 68418.m05709 peptidase S41 family protein similar to C-terminal peptidase of the D1 protein [Hordeum vulgare subsp vulgare] GI:1296805; contains Pfam profiles PF03572: Peptidase family S41B, PF00595: PDZ domain (Also known as DHR or GLGF) Length = 428 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query: 61 IPHIEVGDHIEKLNGENMVGKRHYEVAKILKDIPKGTTFIMRLVEPLKSG 110 I ++ GD I +NG ++ GK +EV+ +L+ K TF++ V+ K G Sbjct: 229 IAGVKQGDEILAVNGMDVSGKSSFEVSSLLQGPSK--TFVVLKVKHGKCG 276 >At4g02400.1 68417.m00324 U3 ribonucleoprotein (Utp) family protein contains Pfam profile: PF04615 Utp14 protein Length = 858 Score = 29.1 bits (62), Expect = 2.6 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 8/130 (6%) Query: 16 FAHRKGRPKEIEIVKTEDALGLTITDNGAGYAFIKRIKEGSIVSRIPHIEVGDHIEKLNG 75 F R K++ V ++ LG ++GA + + E S VS HI+ DHI K+ Sbjct: 258 FQPRTEFEKKMASVLKDNELGEAHKEDGAK---LLELNEASSVSMEDHIKYRDHIAKMRS 314 Query: 76 ENMVGKRHYEVAKILKDIPKGTTFIMRLVEPLKSGFGSIGPKTGSGRSGKKQNFGSGKE- 134 + RH +K +K I T ++ + KS G++ + KQ +E Sbjct: 315 ---LLFRHELKSKRIKKIKSKTYHRLKGKDLKKSAMGALMDPEMAKEEAIKQETRRVEER 371 Query: 135 -TLRFKANGQ 143 TL+ K G+ Sbjct: 372 MTLKHKNTGK 381 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 103 LVEPLKSGFGSIGPKTGSGRSGKK-QNFGSGKETLRFKANGQATIEN-EHDDKSK 155 +VEP +G S+ KT SGK+ Q SGKE K +E E DD+ K Sbjct: 9 IVEPTANGTSSL-QKTSDAISGKEVQENASGKEVQESKKEEDTGLEKMEIDDEGK 62 >At3g12545.1 68416.m01561 lipid transfer protein-related low similarity to Lipid transfer protein [Brassica rapa] GI:3062791; contains Pfam profile PF00152: tRNA synthetases class II (D, K and N) Length = 123 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/26 (46%), Positives = 18/26 (69%) Query: 72 KLNGENMVGKRHYEVAKILKDIPKGT 97 K+NG+ M+G+ +E+A L I KGT Sbjct: 56 KVNGDEMMGRCMHEIANCLVAIDKGT 81 >At4g08097.1 68417.m01316 hypothetical protein Length = 346 Score = 28.3 bits (60), Expect = 4.5 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query: 43 GAGYAFIKRIKEGSIVSRIPHIEVGDHIEKLNGENMVGKRHYEVA--KILKD 92 G I IK SI ++P I D + LN EN++ H A K++KD Sbjct: 284 GVPITLIPTIKYNSIQPKVPLIVNNDPVMVLNDENVLETAHEPSAEQKLIKD 335 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Query: 20 KGRPKEIEIVKTEDALGLTITDNGAGYAFIKRIKEGSIVSRIPHIEVGDHIEKL 73 + P+++ ++ AL LT++ + F+K I G ++R+ + V D +E++ Sbjct: 173 RSNPQKLAVI----ALNLTLSSAKSASKFVKNISHGGGLTRLEVVAVADCVEEI 222 >At1g32490.1 68414.m04009 RNA helicase, putative similar to ATP-dependent RNA helicase #3 [Homo sapiens] GI:3107913; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1044 Score = 28.3 bits (60), Expect = 4.5 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 12/74 (16%) Query: 132 GKETLRFKA-NGQATIENEHDDKSKAGIEKINGLLESFMGINDSELASQMWDLAEGKQNS 190 GK TL+F A N QA+ DD ++IN + ES M + E D + KQ S Sbjct: 337 GKATLKFGAKNKQAS-----DDYQFVFEDQINFIKESVMAGENYE------DAMDAKQKS 385 Query: 191 MELAEAIDNSDLQE 204 +LAE +LQE Sbjct: 386 QDLAEKTALEELQE 399 >At3g01510.1 68416.m00077 5'-AMP-activated protein kinase beta-1 subunit-related contains similarity to Swiss-Prot:P80387 5'-AMP-activated protein kinase, beta-1 subunit (AMPK beta-1 chain) (AMPKb) (40 kDa subunit) [Sus scrofa] Length = 591 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Query: 28 IVKTEDALGLTITDNGAGYAFIKRIKEGSIVSRIPHIEVGDHIEK 72 +V E LG+ + G F+ IK+GS + I VGD ++K Sbjct: 78 MVTLEKPLGIRFALSADGKIFVHAIKKGSNAEKARIIMVGDTLKK 122 >At1g17450.1 68414.m02137 ATP phosphoribosyltransferase -related contains weak similarity to Swiss-Prot:P10366 ATP phosphoribosyltransferase [Escherichia coli] Length = 1402 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Query: 55 GSIVSRIPHIEVGDHIEKLNGENMVGKRHYEVAKILKDIPKGTTFIMRLVEPLKSG 110 G I RI E+G L G+N+ ++ E+ IL DI +G T + KSG Sbjct: 265 GEIHDRIRSFELG-----LRGQNLSKRKSNELIPILNDIQRGQTNVDLDARASKSG 315 >At4g10070.1 68417.m01647 KH domain-containing protein DNA-directed RNA polymerase (EC 2.7.7.6) II largestchain - mouse, PIR2:A28490 Length = 725 Score = 27.5 bits (58), Expect = 7.9 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 6/79 (7%) Query: 18 HRKGRPKEIEIVKTEDALGLTITDNGAGYAFIKRI--KEGSIVSRIPHIEVGDHIEKLNG 75 H G P++IEI D +GL I G G IK + + G+ IP GD +++ Sbjct: 266 HAIGIPEQIEIKVPNDKVGLII---GRGGETIKNMQTRSGARTQLIPQHAEGDGLKERTV 322 Query: 76 ENMVGKRHYEVA-KILKDI 93 K ++A ++KD+ Sbjct: 323 RISGDKMQIDIATDMIKDV 341 >At3g25130.1 68416.m03138 expressed protein Length = 406 Score = 27.5 bits (58), Expect = 7.9 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Query: 134 ETLRFKANGQATIEN-EHDDKSKAGIEKINGLLESFMGINDSELASQMWDLAEGKQNSME 192 E + K ++N E K ++ +K++ + +S D S EGK+N + Sbjct: 203 EEQKVKHKSDVVLDNREEPTKEESKAQKVDLVGDSNNESYDLPKLSNFLGEGEGKRNVVT 262 Query: 193 LAEAIDNSDLQEFG 206 E DN LQ FG Sbjct: 263 KNEEEDNVSLQSFG 276 >At3g16460.2 68416.m02097 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 647 Score = 27.5 bits (58), Expect = 7.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 109 SGFGSIGPKTGSGRSGKKQNFGSGKETLRFKANGQATIENEHDDKSK-AGIEKI 161 +G G+ G TG+G +G G+G + +A G +T DD S G+ KI Sbjct: 227 TGTGT-GTGTGTGGTGTGTGTGTGSGAQKLEAQGNSTGGTSWDDGSDYDGVTKI 279 >At3g16460.1 68416.m02098 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 705 Score = 27.5 bits (58), Expect = 7.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 109 SGFGSIGPKTGSGRSGKKQNFGSGKETLRFKANGQATIENEHDDKSK-AGIEKI 161 +G G+ G TG+G +G G+G + +A G +T DD S G+ KI Sbjct: 227 TGTGT-GTGTGTGGTGTGTGTGTGSGAQKLEAQGNSTGGTSWDDGSDYDGVTKI 279 >At2g47010.2 68415.m05873 expressed protein Length = 451 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 80 GKRHYEVAKILKDIPKGTTFIMRLVEPLKSGFGS 113 G HY+ +LK +P+ F +RL +K G G+ Sbjct: 269 GGYHYDTRGMLKTLPESPNFKVRLTLNVKQGGGA 302 >At2g47010.1 68415.m05872 expressed protein Length = 451 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 80 GKRHYEVAKILKDIPKGTTFIMRLVEPLKSGFGS 113 G HY+ +LK +P+ F +RL +K G G+ Sbjct: 269 GGYHYDTRGMLKTLPESPNFKVRLTLNVKQGGGA 302 >At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family protein / F-box family protein contains similarity to F-box protein FBL2 GI:6010699 from [Rattus norvegicus]; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00646: F-box domain Length = 930 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/42 (28%), Positives = 25/42 (59%) Query: 155 KAGIEKINGLLESFMGINDSELASQMWDLAEGKQNSMELAEA 196 + GI+ + GL +S + E A +W+L+ G+++ +A+A Sbjct: 478 EGGIKILAGLAKSMNRLVAEEAAGGLWNLSVGEEHKNAIAQA 519 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.136 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,574,366 Number of Sequences: 28952 Number of extensions: 247035 Number of successful extensions: 550 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 16 Number of HSP's that attempted gapping in prelim test: 534 Number of HSP's gapped (non-prelim): 32 length of query: 228 length of database: 12,070,560 effective HSP length: 79 effective length of query: 149 effective length of database: 9,783,352 effective search space: 1457719448 effective search space used: 1457719448 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -