BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000397-TA|BGIBMGA000397-PA|IPR001478|PDZ/DHR/GLGF
(228 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 5.4
>AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic
acetylcholine receptorApisa2 subunit protein.
Length = 541
Score = 21.8 bits (44), Expect = 5.4
Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 4/47 (8%)
Query: 86 VAKI-LKDIPKGTTFIMRLVEPLKSGFGSIGPKTGSGRSGKKQNFGS 131
V KI ++ +PK +MR+ + L + + G GRSGKK F +
Sbjct: 336 VRKIFIRRLPK--LLLMRVPDDLLNDLAA-HKMHGRGRSGKKSKFNA 379
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.315 0.136 0.385
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,052
Number of Sequences: 429
Number of extensions: 2421
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 228
length of database: 140,377
effective HSP length: 56
effective length of query: 172
effective length of database: 116,353
effective search space: 20012716
effective search space used: 20012716
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 42 (21.0 bits)
- SilkBase 1999-2023 -