GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000397-TA|BGIBMGA000397-PA|IPR001478|PDZ/DHR/GLGF
         (228 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    22   5.4  

>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 86  VAKI-LKDIPKGTTFIMRLVEPLKSGFGSIGPKTGSGRSGKKQNFGS 131
           V KI ++ +PK    +MR+ + L +   +     G GRSGKK  F +
Sbjct: 336 VRKIFIRRLPK--LLLMRVPDDLLNDLAA-HKMHGRGRSGKKSKFNA 379


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.315    0.136    0.385 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,052
Number of Sequences: 429
Number of extensions: 2421
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 228
length of database: 140,377
effective HSP length: 56
effective length of query: 172
effective length of database: 116,353
effective search space: 20012716
effective search space used: 20012716
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 42 (21.0 bits)