BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000396-TA|BGIBMGA000396-PA|undefined (81 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8484| Best HMM Match : Heme_oxygenase (HMM E-Value=0) 25 6.4 SB_59688| Best HMM Match : K-box (HMM E-Value=0.25) 25 8.5 >SB_8484| Best HMM Match : Heme_oxygenase (HMM E-Value=0) Length = 820 Score = 25.4 bits (53), Expect = 6.4 Identities = 9/22 (40%), Positives = 16/22 (72%) Query: 59 GFSNVKELYEKIAECYEFSPED 80 G ++ E+YEK+++ FSPE+ Sbjct: 412 GMESMAEVYEKLSQLPAFSPEN 433 >SB_59688| Best HMM Match : K-box (HMM E-Value=0.25) Length = 884 Score = 25.0 bits (52), Expect = 8.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 44 FHCQQAHGSPLGLISGFSNVKELYEKIAECYEFSPED 80 F +HGSPL L G + ++ +E + SP + Sbjct: 211 FRSTVSHGSPLSLCHGNEGILHSPDRHSEGFSLSPRN 247 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.311 0.129 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,092,650 Number of Sequences: 59808 Number of extensions: 65732 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 118 Number of HSP's gapped (non-prelim): 2 length of query: 81 length of database: 16,821,457 effective HSP length: 59 effective length of query: 22 effective length of database: 13,292,785 effective search space: 292441270 effective search space used: 292441270 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -