BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000396-TA|BGIBMGA000396-PA|undefined (81 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 0.43 DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 21 4.0 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 24.6 bits (51), Expect = 0.43 Identities = 9/37 (24%), Positives = 22/37 (59%) Query: 23 DTESQSNGVDNSNGTQKSQLVFHCQQAHGSPLGLISG 59 D +S++ G + S G ++ ++ + + +P+G I+G Sbjct: 41 DDDSENEGDEGSGGRRRGRMGGKQPKDYSAPIGFIAG 77 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 61 SNVKELYEKIAECYEFSPEDI 81 + V+E+Y +AE +F +D+ Sbjct: 96 ARVQEIYSAVAETVDFRQKDM 116 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.311 0.129 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,266 Number of Sequences: 2123 Number of extensions: 2146 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 81 length of database: 516,269 effective HSP length: 53 effective length of query: 28 effective length of database: 403,750 effective search space: 11305000 effective search space used: 11305000 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.9 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -