BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000395-TA|BGIBMGA000395-PA|IPR001569|Ribosomal protein L37e (51 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-06 SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) 26 5.0 >SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 45.2 bits (102), Expect = 8e-06 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Query: 6 HWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKEG-KPTPPKKAVASS 51 +WS+KA MRHLK+V RRF+NGF+EG + KK VA++ Sbjct: 2 NWSMKAKRRTTTGTGRMRHLKLVYRRFQNGFQEGTQAKSQKKNVAAA 48 >SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) Length = 1207 Score = 25.8 bits (54), Expect = 5.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 28 VRRRFRNGFKEGKPTPPKKAV 48 +R FR+ ++EGK TP K ++ Sbjct: 510 LREEFRDSYREGKSTPRKFSI 530 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.133 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,555,901 Number of Sequences: 59808 Number of extensions: 31707 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 2 length of query: 51 length of database: 16,821,457 effective HSP length: 31 effective length of query: 20 effective length of database: 14,967,409 effective search space: 299348180 effective search space used: 299348180 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -