BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000395-TA|BGIBMGA000395-PA|IPR001569|Ribosomal protein L37e (51 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosac... 41 2e-05 SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|S... 40 5e-05 SPAC5H10.11 |gmh1||alpha-1,2-galactosyltransferase Gmh1|Schizosa... 22 8.6 >SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 1|||Manual Length = 89 Score = 40.7 bits (91), Expect = 2e-05 Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 5 YHWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKEGKPT 42 Y+W KA M +LK V R F+NGF+ GKPT Sbjct: 47 YNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGFRAGKPT 84 >SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 3|||Manual Length = 91 Score = 39.5 bits (88), Expect = 5e-05 Identities = 18/45 (40%), Positives = 22/45 (48%) Query: 5 YHWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKEGKPTPPKKAVA 49 Y+W KA M +LK V R F+NGF+ GKP A A Sbjct: 47 YNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGFRSGKPAAAVAASA 91 >SPAC5H10.11 |gmh1||alpha-1,2-galactosyltransferase Gmh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 329 Score = 22.2 bits (45), Expect = 8.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 27 IVRRRFRNGFKEGKPT 42 I+ +RF N F EG PT Sbjct: 281 ILPQRFINAFHEGPPT 296 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.321 0.133 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,922 Number of Sequences: 5004 Number of extensions: 4207 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 3 length of query: 51 length of database: 2,362,478 effective HSP length: 32 effective length of query: 19 effective length of database: 2,202,350 effective search space: 41844650 effective search space used: 41844650 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -