BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000394-TA|BGIBMGA000394-PA|IPR004130|Protein of unknown function, ATP binding, IPR010760|Protein of unknown function DUF1337 (356 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 2.4 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 25 3.2 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 2.4 Identities = 13/52 (25%), Positives = 25/52 (48%) Query: 235 EDYSLVTFQLVNMMNEKSLASVKNLVDKANGYVFKTEEDILKGQLRKSEKHQ 286 +D + T +L +M + + + L K N +T +D Q+ K+E H+ Sbjct: 47 KDCAWCTDELYDMRKSRCMTKHELLESKCNALKIETNDDYSFLQIEKNEPHR 98 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 21 PGAGKTTYCIKMSDM 35 P G T YC+K SDM Sbjct: 237 PDTGLTIYCVKASDM 251 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.137 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 331,158 Number of Sequences: 2123 Number of extensions: 12964 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 2 length of query: 356 length of database: 516,269 effective HSP length: 65 effective length of query: 291 effective length of database: 378,274 effective search space: 110077734 effective search space used: 110077734 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -