BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000394-TA|BGIBMGA000394-PA|IPR004130|Protein of unknown function, ATP binding, IPR010760|Protein of unknown function DUF1337 (356 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 25 1.00 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 23 5.3 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 25.0 bits (52), Expect = 1.00 Identities = 13/41 (31%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Query: 36 LKTLGRQVIIVNLDPANDTMNYKPDIDIRELIVLEEVMEQI 76 L+ LGR+ I+VN +P +T++ D D+ + + EE+ ++ Sbjct: 407 LRNLGRKTIMVNYNP--ETVS--TDYDMSDRLYFEEISFEV 443 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.6 bits (46), Expect = 5.3 Identities = 13/54 (24%), Positives = 26/54 (48%) Query: 231 ISIIEDYSLVTFQLVNMMNEKSLASVKNLVDKANGYVFKTEEDILKGQLRKSEK 284 I I + LV V+ + L ++++ + NG K +D+ KG K+++ Sbjct: 4 IIFIFAFCLVGILAVSEESINKLRKIESVCAEENGIDLKKADDVKKGIFDKNDE 57 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.137 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,794 Number of Sequences: 429 Number of extensions: 3676 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 356 length of database: 140,377 effective HSP length: 58 effective length of query: 298 effective length of database: 115,495 effective search space: 34417510 effective search space used: 34417510 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -