Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000393-TA|BGIBMGA000393-PA|IPR002035|von Willebrand
factor, type A
         (366 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    22   6.1  

>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 11/41 (26%), Positives = 21/41 (51%)

Query: 305 TAASNNRQRPALQMNAVQSTSQIRRSASTGRLPSLNISKES 345
           T    ++  PA    +V + + I   +++   P++NI KES
Sbjct: 202 TKVKASKASPAAAPRSVATPTGIPTPSTSASPPTVNIKKES 242


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.132    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,819
Number of Sequences: 317
Number of extensions: 2978
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 366
length of database: 114,650
effective HSP length: 58
effective length of query: 308
effective length of database: 96,264
effective search space: 29649312
effective search space used: 29649312
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)