BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000393-TA|BGIBMGA000393-PA|IPR002035|von Willebrand
factor, type A
(366 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 6.1
>AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1
protein protein.
Length = 371
Score = 22.2 bits (45), Expect = 6.1
Identities = 11/41 (26%), Positives = 21/41 (51%)
Query: 305 TAASNNRQRPALQMNAVQSTSQIRRSASTGRLPSLNISKES 345
T ++ PA +V + + I +++ P++NI KES
Sbjct: 202 TKVKASKASPAAAPRSVATPTGIPTPSTSASPPTVNIKKES 242
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.317 0.132 0.392
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,819
Number of Sequences: 317
Number of extensions: 2978
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 366
length of database: 114,650
effective HSP length: 58
effective length of query: 308
effective length of database: 96,264
effective search space: 29649312
effective search space used: 29649312
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -