BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000393-TA|BGIBMGA000393-PA|IPR002035|von Willebrand factor, type A (366 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 9.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 9.6 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 9.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 326 QIRRSASTGRLPSLNISKES 345 Q +R+ + GRL S N+SK+S Sbjct: 242 QKKRTRAEGRLSSDNMSKKS 261 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 9.6 Identities = 13/67 (19%), Positives = 29/67 (43%) Query: 49 WAFRRTVAILIKGSRTQRKDEGDIEISTHMKFNNERWETLNSYLESDEPFSEETFRRVLG 108 + + +VA++ + K E+ H+ FN+E + + D ++T+ + Sbjct: 138 YLYALSVAVIHRPDTKLMKLPPMYEVMPHLYFNDEVMQKAYNIAMGDTADMKKTYNNIDY 197 Query: 109 YIEGAIY 115 Y+ A Y Sbjct: 198 YLLAANY 204 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.132 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,307 Number of Sequences: 429 Number of extensions: 3657 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 366 length of database: 140,377 effective HSP length: 59 effective length of query: 307 effective length of database: 115,066 effective search space: 35325262 effective search space used: 35325262 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -