BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000389-TA|BGIBMGA000389-PA|undefined (155 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0594 - 18831011-18831360,18831562-18832111,18832364-188334... 31 0.42 01_01_1111 - 8791925-8792649,8793506-8793890,8794341-8794618,879... 30 0.96 12_01_0147 + 1138382-1138532,1138660-1138967,1139233-1139934 27 5.1 11_01_0147 + 1235437-1235587,1235715-1236022,1236266-1236961 27 5.1 06_02_0272 + 13646814-13647305,13647983-13648612 27 6.8 04_04_0508 + 25746949-25747117,25748561-25748826,25748934-25749335 27 6.8 06_03_0306 - 19396423-19397112,19397645-19397916,19398047-19398215 27 9.0 06_01_0029 - 288676-289287,289441-289733,289842-290031 27 9.0 05_04_0352 + 20533846-20534038,20534117-20534391,20535134-20535634 27 9.0 04_04_0634 - 26777889-26778452,26778526-26778797,26778905-267791... 27 9.0 04_03_1016 + 21742060-21742219,21742301-21742596,21742705-217427... 27 9.0 03_06_0439 + 33952765-33953238,33953368-33953844 27 9.0 03_03_0184 + 15228045-15228405,15228725-15228883,15228984-152292... 27 9.0 03_01_0136 + 1069136-1069292,1070783-1071060,1071246-1071602,107... 27 9.0 >09_04_0594 - 18831011-18831360,18831562-18832111,18832364-18833406, 18833496-18833760,18835194-18835340,18835431-18835511, 18835626-18835804,18835935-18836093,18836269-18836398, 18836935-18837094,18837337-18837419,18837865-18837915, 18838035-18838151,18838273-18838359 Length = 1133 Score = 31.1 bits (67), Expect = 0.42 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 38 ETDDLKTAANAWYIYSNFDRNYPDGS 63 E L+T W+ +S DR YP+GS Sbjct: 487 ERSALRTGDKQWFFFSRMDRKYPNGS 512 >01_01_1111 - 8791925-8792649,8793506-8793890,8794341-8794618, 8794998-8795163 Length = 517 Score = 29.9 bits (64), Expect = 0.96 Identities = 11/25 (44%), Positives = 16/25 (64%) Query: 41 DLKTAANAWYIYSNFDRNYPDGSSS 65 D+ T N W+ ++ DR YP+GS S Sbjct: 59 DVPTQDNKWHFFAARDRKYPNGSRS 83 >12_01_0147 + 1138382-1138532,1138660-1138967,1139233-1139934 Length = 386 Score = 27.5 bits (58), Expect = 5.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 47 NAWYIYSNFDRNYPDGS 63 N WY +S DR YP+G+ Sbjct: 58 NEWYFFSPRDRKYPNGA 74 >11_01_0147 + 1235437-1235587,1235715-1236022,1236266-1236961 Length = 384 Score = 27.5 bits (58), Expect = 5.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 47 NAWYIYSNFDRNYPDGS 63 N WY +S DR YP+G+ Sbjct: 58 NEWYFFSPRDRKYPNGA 74 >06_02_0272 + 13646814-13647305,13647983-13648612 Length = 373 Score = 27.1 bits (57), Expect = 6.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Query: 36 FEETDDLKTAANAWYIYSNFDRNYPDG 62 +E + K WY YS DR YP G Sbjct: 66 WELPEKAKMGEKEWYFYSLRDRKYPTG 92 >04_04_0508 + 25746949-25747117,25748561-25748826,25748934-25749335 Length = 278 Score = 27.1 bits (57), Expect = 6.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 36 FEETDDLKTAANAWYIYSNFDRNYPDGS 63 +E D K A+ WY +S DR Y GS Sbjct: 53 WELPDVAKLTASEWYFFSFRDRKYATGS 80 >06_03_0306 - 19396423-19397112,19397645-19397916,19398047-19398215 Length = 376 Score = 26.6 bits (56), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 47 NAWYIYSNFDRNYPDGS 63 N WY +S+ D+ YP G+ Sbjct: 67 NEWYFFSHKDKKYPTGT 83 >06_01_0029 - 288676-289287,289441-289733,289842-290031 Length = 364 Score = 26.6 bits (56), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 47 NAWYIYSNFDRNYPDGS 63 N WY +S+ D+ YP G+ Sbjct: 78 NEWYFFSHKDKKYPTGT 94 >05_04_0352 + 20533846-20534038,20534117-20534391,20535134-20535634 Length = 322 Score = 26.6 bits (56), Expect = 9.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 49 WYIYSNFDRNYPDGS 63 WY +S DR YP+GS Sbjct: 74 WYFFSPRDRKYPNGS 88 >04_04_0634 - 26777889-26778452,26778526-26778797,26778905-26779117, 26779497-26779578 Length = 376 Score = 26.6 bits (56), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 47 NAWYIYSNFDRNYPDGS 63 N WY +S+ D+ YP G+ Sbjct: 109 NEWYFFSHKDKKYPTGT 125 >04_03_1016 + 21742060-21742219,21742301-21742596,21742705-21742758, 21743480-21743503 Length = 177 Score = 26.6 bits (56), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 1 MNLKIPIIFLFGCTFAALKTEAALHENLLAD 31 + LK +IF G F A+KT +HE L D Sbjct: 95 VGLKKTLIFFIGEPFEAIKTNWVMHEYHLMD 125 >03_06_0439 + 33952765-33953238,33953368-33953844 Length = 316 Score = 26.6 bits (56), Expect = 9.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 46 ANAWYIYSNFDRNYPDGS 63 A WY ++ DR YP+GS Sbjct: 70 AREWYFFTPRDRKYPNGS 87 >03_03_0184 + 15228045-15228405,15228725-15228883,15228984-15229258, 15229346-15229594,15229670-15229788,15229874-15229972, 15230068-15230176,15230281-15230421 Length = 503 Score = 26.6 bits (56), Expect = 9.0 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Query: 30 ADETNTFEETDDLKTAANAWYIYSNFDRNYPDGSSSVYRHGFVTG 74 ++ T+ ++ T D TAA+A+ +N+ +P+ R F+TG Sbjct: 191 SNTTSDYDNTGDTSTAADAYTFLTNWLERFPEYKG---RDFFITG 232 >03_01_0136 + 1069136-1069292,1070783-1071060,1071246-1071602, 1071706-1072119,1072221-1072302,1072429-1073093 Length = 650 Score = 26.6 bits (56), Expect = 9.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 49 WYIYSNFDRNYPDGS 63 WY +S DR YP+GS Sbjct: 64 WYFFSPRDRKYPNGS 78 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,000,258 Number of Sequences: 37544 Number of extensions: 80659 Number of successful extensions: 189 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 174 Number of HSP's gapped (non-prelim): 16 length of query: 155 length of database: 14,793,348 effective HSP length: 76 effective length of query: 79 effective length of database: 11,940,004 effective search space: 943260316 effective search space used: 943260316 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -