BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000388-TA|BGIBMGA000388-PA|IPR000618|Insect cuticle protein, IPR008160|Collagen triple helix repeat (1624 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 29 1.00 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 29 1.00 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 29 1.00 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 29 1.00 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 29 1.00 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 29 1.00 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 29 1.00 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 29 1.00 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 29 1.00 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 29 1.00 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 29 1.00 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 29 1.00 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 29 1.00 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 29 1.3 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 29.1 bits (62), Expect = 1.00 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 136 ENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 E+R D VV G Y VD +G R Y AD H Sbjct: 42 ESRDGD-VVQGSYSVVDPDGTKRTVDYTADPH 72 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 110 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 141 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 102 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 133 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 102 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 133 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 102 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 133 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 102 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 133 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 110 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 141 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 134 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 165 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 102 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 133 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 110 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 141 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 102 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 133 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 110 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 141 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.1 bits (62), Expect = 1.00 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 102 HETRHGDEV-HGQYSLLDSDGHQRIVDYHADHH 133 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 28.7 bits (61), Expect = 1.3 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 135 HENRGPDGVVYGCYGYVDTEGYLRATHYVADSH 167 HE R D V +G Y +D++G+ R Y AD H Sbjct: 110 HETRHGDEV-HGQYSLLDSDGHHRIVDYHADHH 141 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.134 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,418 Number of Sequences: 2123 Number of extensions: 21211 Number of successful extensions: 91 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 77 Number of HSP's gapped (non-prelim): 14 length of query: 1624 length of database: 516,269 effective HSP length: 73 effective length of query: 1551 effective length of database: 361,290 effective search space: 560360790 effective search space used: 560360790 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -