GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000388-TA|BGIBMGA000388-PA|IPR000618|Insect cuticle
protein, IPR008160|Collagen triple helix repeat
         (1624 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                24   8.8  

>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 24.2 bits (50), Expect = 8.8
 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 3/59 (5%)

Query: 1496 PGNNGTATNEMQASSHPANGQSQGYAPYGIIGFIPVVFVPYCP---GNGSAMNTAQQNF 1551
            P N+G   +  Q     + GQS  ++P  +   +     P  P   G G A  T ++ F
Sbjct: 12   PDNDGKMVDLTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGEGMAGVTGEEPF 70


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.313    0.134    0.418 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,806
Number of Sequences: 429
Number of extensions: 6477
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 9
Number of HSP's gapped (non-prelim): 1
length of query: 1624
length of database: 140,377
effective HSP length: 67
effective length of query: 1557
effective length of database: 111,634
effective search space: 173814138
effective search space used: 173814138
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 50 (24.2 bits)