BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000384-TA|BGIBMGA000384-PA|IPR008973|C2 calcium/lipid-binding region, CaLB (318 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC ... 35 0.063 At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC ... 35 0.063 At2g20990.1 68415.m02485 C2 domain-containing protein (sytA) sim... 34 0.11 At1g20080.1 68414.m02513 C2 domain-containing protein contains I... 33 0.25 At2g21010.1 68415.m02489 C2 domain-containing protein contains I... 31 0.77 At5g25070.1 68418.m02971 expressed protein 31 1.0 At4g13550.1 68417.m02112 lipase class 3 family protein very low ... 30 1.8 At2g21040.1 68415.m02495 C2 domain-containing protein low simila... 30 1.8 At2g10440.1 68415.m01097 hypothetical protein 30 2.4 At4g27220.1 68417.m03909 disease resistance protein (NBS-LRR cla... 29 3.1 At4g20160.1 68417.m02949 expressed protein ; expression supporte... 29 3.1 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 29 3.1 At5g58900.1 68418.m07379 myb family transcription factor contain... 29 4.1 At4g28230.1 68417.m04045 expressed protein 29 4.1 At5g58690.1 68418.m07353 phosphoinositide-specific phospholipase... 29 5.4 At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase... 29 5.4 At3g62720.1 68416.m07045 galactosyl transferase GMA12/MNN10 fami... 29 5.4 At2g20000.1 68415.m02338 cell division cycle family protein / CD... 29 5.4 At2g17580.1 68415.m02034 polynucleotide adenylyltransferase fami... 29 5.4 At1g58200.2 68414.m06607 mechanosensitive ion channel domain-con... 29 5.4 At1g58200.1 68414.m06606 mechanosensitive ion channel domain-con... 29 5.4 At4g32900.2 68417.m04682 expressed protein 28 7.2 At4g32900.1 68417.m04681 expressed protein 28 7.2 At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase... 28 7.2 At2g38440.1 68415.m04721 expressed protein 28 7.2 At5g55720.1 68418.m06946 pectate lyase family protein similar to... 28 9.5 At5g11100.1 68418.m01296 C2 domain-containing protein similar to... 28 9.5 At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 28 9.5 >At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC donor splice site at exon 3; similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 540 Score = 35.1 bits (77), Expect = 0.063 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Query: 4 VKVFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSG-HFLS 57 V +F GE K L++ P WNE+F+F L++ K+S ++++ + +G HF S Sbjct: 444 VVLFRGEKKKTKMLKKTRDPRWNEEFQFTLEEPPVKESI-RVEVMSKGTGFHFRS 497 >At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC donor splice site at exon 3; similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 318 Score = 35.1 bits (77), Expect = 0.063 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Query: 4 VKVFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSG-HFLS 57 V +F GE K L++ P WNE+F+F L++ K+S ++++ + +G HF S Sbjct: 222 VVLFRGEKKKTKMLKKTRDPRWNEEFQFTLEEPPVKESI-RVEVMSKGTGFHFRS 275 >At2g20990.1 68415.m02485 C2 domain-containing protein (sytA) similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 541 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/105 (23%), Positives = 50/105 (47%), Gaps = 4/105 (3%) Query: 11 SKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKI-DLQNLVSGHFLSLTIYAILE--PP 67 SK T +N P WNE+FKF ++ + + + D + + + + + + A+ E P Sbjct: 296 SKKTTVKHKNLNPEWNEEFKFSVRDPQTQVLEFSVYDWEQVGNPEKMGMNVLALKEMVPD 355 Query: 68 KQEADKRKNSKTID-TKNAKVGDQEEPKAKTGFLEKTFSSFKATK 111 + +A + KT+D ++ + D+ K + L K F+ + K Sbjct: 356 EHKAFTLELRKTLDGGEDGQPPDKYRGKLEVELLYKPFTEEEMPK 400 Score = 31.5 bits (68), Expect = 0.77 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 11/89 (12%) Query: 7 FPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSL-----TI- 60 F GE + +++N P WNE+F F L++ + +K+ ++ L + + L T+ Sbjct: 446 FKGEERKTKHVKKNRDPRWNEEFTFMLEEPPVR---EKLHVEVLSTSSRIGLLHPKETLG 502 Query: 61 YAILEPPKQEADKRKNSK--TIDTKNAKV 87 Y + +KR N K ID+KN K+ Sbjct: 503 YVDIPVVDVVNNKRMNQKFHLIDSKNGKI 531 >At1g20080.1 68414.m02513 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 535 Score = 33.1 bits (72), Expect = 0.25 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 9/88 (10%) Query: 6 VFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSG----HFLSLTIY 61 +F GE + +++N P W+EDF+F L + +DK+ ++ + S H Y Sbjct: 441 LFRGEERKTKRVKKNREPRWDEDFQFPLDEPPI---NDKLHVEVISSSSRLIHPKETLGY 497 Query: 62 AILEPPKQEADKRKNSK--TIDTKNAKV 87 ++ +++R N K ID+KN ++ Sbjct: 498 VVINLGDVVSNRRINDKYHLIDSKNGRI 525 >At2g21010.1 68415.m02489 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 256 Score = 31.5 bits (68), Expect = 0.77 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Query: 7 FPGESKYETTLQENSWPVWNEDFKFQLKQKEA-KKSSDKIDLQNLVSGHFLSLTIYAILE 65 F GE + +++N P WNE+F F L++ +K ++ + G ++ Sbjct: 161 FKGEERKTKNVKKNKDPKWNEEFSFMLEEPPVHEKLHVEVFSTSSRIGLLHPKETLGYVD 220 Query: 66 PPKQEA--DKRKNSK--TIDTKNAKV 87 P + +KR N K ID+KN K+ Sbjct: 221 IPVVDVVNNKRMNQKFHLIDSKNGKI 246 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Query: 11 SKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGH-FLSLTIYAI--LEPP 67 SK T +N P WNE+FKF ++ + + + + H + + + A+ L P Sbjct: 19 SKKTTVKHKNLNPEWNEEFKFSVRDPKTQVLEFNVYGWEKIGKHDKMGMNVLALKELAPD 78 Query: 68 KQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLE 101 +++A + KT+D G++ +P G LE Sbjct: 79 ERKAFTLELRKTLDG-----GEEGQPGKYRGKLE 107 >At5g25070.1 68418.m02971 expressed protein Length = 736 Score = 31.1 bits (67), Expect = 1.0 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 8/95 (8%) Query: 33 LKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEE 92 LK++ +KKS I QN+ S F+ ++ P+ EA+K+ + T +N K + Sbjct: 540 LKERSSKKS---IIQQNITS--FMDKIMFIEKRMPELEAEKKVAAST---RNFKEAGRIA 591 Query: 93 PKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRTV 127 +AK+ LEK + + KA A +K+ E T+ Sbjct: 592 AEAKSLNLEKDKTQMETGKANAELEKAEHEIEETI 626 >At4g13550.1 68417.m02112 lipase class 3 family protein very low similarity to diacylglycerol lipase [Aspergillus oryzae] GI:1772352; contains Pfam profiles PF01764: Lipase (class 3), PF00168: C2 domain Length = 785 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/32 (46%), Positives = 17/32 (53%) Query: 23 PVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGH 54 P WNEDF F +K AKK NLV+ H Sbjct: 116 PKWNEDFVFNIKLPPAKKIEIAAWDANLVTPH 147 >At2g21040.1 68415.m02495 C2 domain-containing protein low similarity to phloem protein [Cucurbita maxima] GI:4164541; contains Pfam profile PF00168: C2 domain Length = 261 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Query: 7 FPGESKYETTLQENSWPVWNEDFKFQLKQ 35 F GE + +++N P WNE+F F L++ Sbjct: 42 FKGEERKTKHVKKNKDPKWNEEFSFMLEE 70 >At2g10440.1 68415.m01097 hypothetical protein Length = 935 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Query: 141 NDLKNGLIGTPDIWRPINAIASGITASEKRGENTKGQLEVTLLYTASEDGLNDVVQLTVN 200 + L++ ++ T +N IA G ++ E T G+L T++ ED L +V T Sbjct: 751 SSLESEVVSTTSSGLKVNNIAPGYALLQEIKE-TNGRLVETVVEICDEDSLGTIVTCTYA 809 Query: 201 RLRCSVHTMQEHEKYKAPLYLKATILEA 228 + S ++ K Y+ +++A Sbjct: 810 PVALSATFKDHYKSGKIIFYVSKCLMQA 837 >At4g27220.1 68417.m03909 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 919 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Query: 142 DLKNGLIGTPDIWRPINAIASGITASEKRGENTK 175 DLKN L+ D+W PI+ GI + +R +++K Sbjct: 214 DLKNFLLILDDVWHPIDLDQLGIPLALERSKDSK 247 >At4g20160.1 68417.m02949 expressed protein ; expression supported by MPSS Length = 1188 Score = 29.5 bits (63), Expect = 3.1 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 6/75 (8%) Query: 68 KQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRTV 127 K+ A + +T++ K K +E+ +K LE ++TK +AIA++S+ EK V Sbjct: 425 KKLAGETIQKETVEGKGEKRETKEKVISKES-LEGKGEKRESTKEKAIAKESVAEK-ALV 482 Query: 128 GAA----TWNFDSKL 138 G A WN D K+ Sbjct: 483 GIAEKVNLWNSDEKM 497 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 29.5 bits (63), Expect = 3.1 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 11/80 (13%) Query: 67 PKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRT 126 PK+E+ ++K I K A+ GD +P AK + T A+ I +K I+ +R Sbjct: 789 PKEESTGTSSNKKIVKKVAETGDTSDPSAKAN---------EQTPAKTIVKKKII--KRV 837 Query: 127 VGAATWNFDSKLFQNDLKNG 146 D+K+ + K+G Sbjct: 838 AKRKVAEIDNKMDGDSKKDG 857 >At5g58900.1 68418.m07379 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 288 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 130 ATWNF-DSKLFQNDLKNGLIGTPDIWRPINAIASGITASE 168 ATW ++K F+N L TPD W+ + A+ G T S+ Sbjct: 32 ATWTAAENKAFENALAVYDDNTPDRWQKVAAVIPGKTVSD 71 >At4g28230.1 68417.m04045 expressed protein Length = 402 Score = 29.1 bits (62), Expect = 4.1 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 13/123 (10%) Query: 9 GESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPP- 67 G+S+ + ++ +SW NE F ++ S LQ+ VS I E P Sbjct: 27 GDSQITSAIEASSWSHLNESFDSDCSKENQFPISVSSSLQSSVS----------ITEAPS 76 Query: 68 -KQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRT 126 K + K K++ K + EE + + G L S + KAE A +SI + R Sbjct: 77 AKSKTVKTKSAADRSKKRDIDAEIEEVEKEIGRLSTKLESLRLEKAEQTA-RSIAIRGRI 135 Query: 127 VGA 129 V A Sbjct: 136 VPA 138 >At5g58690.1 68418.m07353 phosphoinositide-specific phospholipase C family protein contains Pfam profile: PF00388 phosphatidylinositol-specific phospholipase C Length = 578 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 14 ETTLQENSW-PVWNEDFKFQLKQKE 37 +T ++ +W P WNE+F+FQL E Sbjct: 495 KTKKEQKTWEPFWNEEFEFQLTVPE 519 >At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase C (PLC1) identical to phosphoinositide specific phospholipase C [Arabidopsis thaliana] GI:902923 Length = 561 Score = 28.7 bits (61), Expect = 5.4 Identities = 9/28 (32%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 11 SKYETTLQENSW-PVWNEDFKFQLKQKE 37 + Y T + ++ W P+W+++F+F L+ E Sbjct: 473 ASYRTEIDKDEWFPIWDKEFEFPLRVPE 500 >At3g62720.1 68416.m07045 galactosyl transferase GMA12/MNN10 family protein low similarity to alpha-1,2-galactosyltransferase, Schizosaccharomyces pombe [SP|Q09174] Length = 460 Score = 28.7 bits (61), Expect = 5.4 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 146 GLIGTPDIWRPINAIASGITASEKRGENTKGQLEVTLLYTASEDGLN 192 G GTP+ + I I + KRGE + +EV+ T+SEDG N Sbjct: 42 GKFGTPE--KDIEEIREHFFYTRKRGEPHRVLVEVSSKTTSSEDGGN 86 >At2g20000.1 68415.m02338 cell division cycle family protein / CDC family protein low similarity to SP|P30260|CC27_HUMAN Protein CDC27Hs (Cell division cycle protein 27 homolog) Homo sapiens; contains Pfam profile PF00515: TPR Domain Length = 744 Score = 28.7 bits (61), Expect = 5.4 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Query: 46 DLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFS 105 ++ N +GH+L IY + K A + K S TID + E G E+ + Sbjct: 96 EIPNGAAGHYLLGLIYKYTDRRKNAAQQFKQSLTID---PLLWAAYEELCILGAAEEATA 152 Query: 106 SFKATKAEAIAQKSILEKRRTVGAATWN 133 F T A +I ++ + + ++G T+N Sbjct: 153 VFGETAALSIQKQYMQQLSTSLGLNTYN 180 >At2g17580.1 68415.m02034 polynucleotide adenylyltransferase family protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profile PF01743: polyA polymerase family protein Length = 757 Score = 28.7 bits (61), Expect = 5.4 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Query: 63 ILEPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFL-EKTFSSFKATKAEAIAQKSIL 121 I E PKQ+ K + ++ K+ + +E +AK GF+ +K+ S ++ Q S Sbjct: 676 ICELPKQKTSKNHSKESRKVKHNDLPVKEIKEAKQGFVSDKSMSDLLQVLEKSSQQVSSK 735 Query: 122 EKRRTVGAATWNFDSKL 138 E+ ++ + N KL Sbjct: 736 EENNSLSSEKTNRPRKL 752 >At1g58200.2 68414.m06607 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 678 Score = 28.7 bits (61), Expect = 5.4 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%) Query: 65 EPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFS--SFKATKAEAIAQKSILE 122 E P + + +N+ ++ NAK +E KA G T + S +T + +AQKS + Sbjct: 526 EEPSETKAETENNGSVPVSNAK---KENQKAALGSNSNTGTKGSSTSTSDQPVAQKSEEK 582 Query: 123 KRRTVG 128 K+ +VG Sbjct: 583 KKESVG 588 >At1g58200.1 68414.m06606 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 678 Score = 28.7 bits (61), Expect = 5.4 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%) Query: 65 EPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFS--SFKATKAEAIAQKSILE 122 E P + + +N+ ++ NAK +E KA G T + S +T + +AQKS + Sbjct: 526 EEPSETKAETENNGSVPVSNAK---KENQKAALGSNSNTGTKGSSTSTSDQPVAQKSEEK 582 Query: 123 KRRTVG 128 K+ +VG Sbjct: 583 KKESVG 588 >At4g32900.2 68417.m04682 expressed protein Length = 139 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/65 (26%), Positives = 28/65 (43%) Query: 22 WPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTID 81 WP + Q ++E K S +NL+ G + I IL+ +Q K S+ + Sbjct: 2 WPSSRNSSQPQAMRQEKKSISVSFRAENLIPGVVIGFIIGMILDLSQQVTSPVKRSRLLS 61 Query: 82 TKNAK 86 +K K Sbjct: 62 SKVQK 66 >At4g32900.1 68417.m04681 expressed protein Length = 143 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/65 (26%), Positives = 28/65 (43%) Query: 22 WPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTID 81 WP + Q ++E K S +NL+ G + I IL+ +Q K S+ + Sbjct: 2 WPSSRNSSQPQAMRQEKKSISVSFRAENLIPGVVIGFIIGMILDLSQQVTSPVKRSRLLS 61 Query: 82 TKNAK 86 +K K Sbjct: 62 SKVQK 66 >At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase C family protein contains Pfam profile: PF00388 phosphatidylinositol-specific phospholipase C Length = 613 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 11 SKYETTLQENSW-PVWNEDFKFQLKQKE 37 +K +T + E++W P+W+E+F F L E Sbjct: 527 AKKKTKIIEDNWYPIWDEEFSFPLTVPE 554 >At2g38440.1 68415.m04721 expressed protein Length = 1399 Score = 28.3 bits (60), Expect = 7.2 Identities = 29/129 (22%), Positives = 52/129 (40%), Gaps = 8/129 (6%) Query: 8 PGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPP 67 P + ET+ E SW + K Q ++ A + + +N +S H ++ + Sbjct: 164 PSFVRLETSSYEESWDDIQREKKSQKAKRRASQWRNGGTPENALSSH---AKLHELFLEE 220 Query: 68 KQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRTV 127 EA ++ + K K+ D +K+G E F T+ ++ I+ + Sbjct: 221 HLEAHHSDPARVVKLKTRKL-DGCSLISKSG--ESYMEKFVQTRVDSKISYEII--TQNP 275 Query: 128 GAATWNFDS 136 G TWN DS Sbjct: 276 GLLTWNMDS 284 >At5g55720.1 68418.m06946 pectate lyase family protein similar to pectate lyase 1 GP:6606532 from [Musa acuminata] Length = 392 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Query: 8 PGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQ--NLVSGHFLSLTIYAI 63 PG +Y T + W +++ D QLKQ S ID + N+ + LT+Y + Sbjct: 103 PGTLRYAATQDQPLWIIFDRDMVIQLKQDLQVASYKTIDGRGNNVQIAYGPCLTLYKV 160 >At5g11100.1 68418.m01296 C2 domain-containing protein similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 574 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 1 ILQVKVFPGESKYETTLQENSWPVWNEDFKF 31 I+ ++ P +K T+ + P+WNE F+F Sbjct: 297 IVFIRPLPDRTKKTKTISNSLNPIWNEHFEF 327 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/65 (24%), Positives = 33/65 (50%) Query: 27 EDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAK 86 ++ K K+KE K + ID N+VS + + P +A++ ++ + D++N + Sbjct: 401 KEIKEVKKRKERTKELEGIDTSNIVSSSRRRSSASFVPPPKPIKAEESESDDSEDSENEE 460 Query: 87 VGDQE 91 D+E Sbjct: 461 DEDEE 465 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.314 0.129 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,222,461 Number of Sequences: 28952 Number of extensions: 280828 Number of successful extensions: 731 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 710 Number of HSP's gapped (non-prelim): 36 length of query: 318 length of database: 12,070,560 effective HSP length: 81 effective length of query: 237 effective length of database: 9,725,448 effective search space: 2304931176 effective search space used: 2304931176 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -