BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000384-TA|BGIBMGA000384-PA|IPR008973|C2 calcium/lipid-binding region, CaLB (318 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.73 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 6.8 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 9.0 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.0 bits (52), Expect = 0.73 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 16/95 (16%) Query: 147 LIGTPDIWRPINAIASGITASEKR-----GENTKGQLEVTLLYTASEDGLNDVVQLTVNR 201 + G D W N + ITA+ + + T +EV L YT+ DG+ Sbjct: 1139 IYGPSDTWFDENTKDTKITAASETILHGLKKYTNYSMEV-LAYTSGGDGVRTT------- 1190 Query: 202 LRCSVHTMQEHEKYKAPLYLKATILEANKAECFWK 236 +H E + +AP+ +KA ++ + WK Sbjct: 1191 ---PIHCQTEQDVPEAPIAVKALVMSTDSILASWK 1222 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 156 PINAIASGITASEKRGENTKGQLE 179 PI +A G+ + K+ EN K + E Sbjct: 62 PIGFVAGGVQQAGKKPENVKKEDE 85 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 154 WRPINAIASGITASEK 169 W NAI +GI AS K Sbjct: 105 WNAGNAILNGIVASSK 120 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.129 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,938 Number of Sequences: 317 Number of extensions: 2650 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 318 length of database: 114,650 effective HSP length: 57 effective length of query: 261 effective length of database: 96,581 effective search space: 25207641 effective search space used: 25207641 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -