BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000383-TA|BGIBMGA000383-PA|IPR002085|Alcohol dehydrogenase superfamily, zinc-containing (370 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 25 0.66 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 0.66 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 8.1 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 25.4 bits (53), Expect = 0.66 Identities = 14/55 (25%), Positives = 27/55 (49%) Query: 303 LYLCDYLFPGEAPAEALLSVRELLDLKITETDVICDVETPAGAQIFVFLEIILLN 357 L CD G AL ++ L ++ +T VIC + P+ +F +++L++ Sbjct: 240 LMFCDEPTSGLDSFMALTVMQVLKEMAMTGKTVICTIHQPSSEVYSMFDKLLLMS 294 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 25.4 bits (53), Expect = 0.66 Identities = 14/55 (25%), Positives = 27/55 (49%) Query: 303 LYLCDYLFPGEAPAEALLSVRELLDLKITETDVICDVETPAGAQIFVFLEIILLN 357 L CD G AL ++ L ++ +T VIC + P+ +F +++L++ Sbjct: 240 LMFCDEPTSGLDSFMALTVMQVLKEMAMTGKTVICTIHQPSSEVYSMFDKLLLMS 294 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 8.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 30 LGQMTDARENVIHLARTPEEKGSEIGIESNYGLD 63 L + +D IH +E+G I + N G+D Sbjct: 308 LKRWSDRIYAAIHQGSVTDERGRSITLTENEGID 341 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,551 Number of Sequences: 317 Number of extensions: 3637 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 3 length of query: 370 length of database: 114,650 effective HSP length: 58 effective length of query: 312 effective length of database: 96,264 effective search space: 30034368 effective search space used: 30034368 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -