BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000383-TA|BGIBMGA000383-PA|IPR002085|Alcohol dehydrogenase superfamily, zinc-containing (370 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 9.7 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 9.7 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 9.7 Identities = 18/66 (27%), Positives = 29/66 (43%) Query: 152 STKVLTCKSLEVGGLNKNTTLKPVEWKFSPKALSWQRLDCYYEFDEIYPVIVKNSGVSVK 211 S+ L S ++ +N TLK V+ K ALS + YY + N+ +K Sbjct: 225 SSHTLNHNSDKMSDQQENLTLKEVDNKVYGMALSPVTHNLYYNSPSSENLYYVNTESLMK 284 Query: 212 NQFQEN 217 ++ Q N Sbjct: 285 SENQGN 290 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.8 bits (44), Expect = 9.7 Identities = 9/26 (34%), Positives = 18/26 (69%) Query: 202 IVKNSGVSVKNQFQENTLPETVEYLE 227 +VK+S ++V+ Q QEN + V+ ++ Sbjct: 324 VVKSSELAVRIQRQENNIRPMVKQID 349 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,653 Number of Sequences: 429 Number of extensions: 4253 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 370 length of database: 140,377 effective HSP length: 59 effective length of query: 311 effective length of database: 115,066 effective search space: 35785526 effective search space used: 35785526 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -