BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000380-TA|BGIBMGA000380-PA|IPR000408|Regulator of chromosome condensation, RCC1 (163 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18553| Best HMM Match : fn3 (HMM E-Value=0.25) 27 5.7 SB_9151| Best HMM Match : WAP (HMM E-Value=0.045) 27 5.7 >SB_18553| Best HMM Match : fn3 (HMM E-Value=0.25) Length = 1702 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Query: 39 SVKSRMSYGSVEIERSFAAGI---RHGATLVSEKRSFEF 74 ++KS M+YGS+ SF + +GA LVSE +S F Sbjct: 745 TLKSNMTYGSIPGNSSFYYNVIKCTNGAKLVSESKSNGF 783 >SB_9151| Best HMM Match : WAP (HMM E-Value=0.045) Length = 1865 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Query: 39 SVKSRMSYGSVEIERSFAAGI---RHGATLVSEKRSFEF 74 ++KS M+YGS+ SF + +GA LVSE +S F Sbjct: 1432 TLKSNMTYGSIPGNSSFYYNVIKCTNGAKLVSESKSNGF 1470 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,070,417 Number of Sequences: 59808 Number of extensions: 65263 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 74 Number of HSP's gapped (non-prelim): 2 length of query: 163 length of database: 16,821,457 effective HSP length: 77 effective length of query: 86 effective length of database: 12,216,241 effective search space: 1050596726 effective search space used: 1050596726 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -