BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000378-TA|BGIBMGA000378-PA|IPR000697|EVH1
(779 letters)
Database: celegans
27,539 sequences; 12,573,161 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z73898-5|CAI46588.1| 124|Caenorhabditis elegans Hypothetical pr... 31 3.1
>Z73898-5|CAI46588.1| 124|Caenorhabditis elegans Hypothetical
protein ZK822.6 protein.
Length = 124
Score = 31.1 bits (67), Expect = 3.1
Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 6/54 (11%)
Query: 39 WAEVFHVSASGAGTVKWQQVSEDLVPVNITCIQDSPECVFHITAYNSQVDKILD 92
WAE + V++ A K Q+VS+ + NIT + + +++ NSQ+ KILD
Sbjct: 30 WAETYKVTSQYAQYQKDQKVSKAQMESNIT------QLISKLSSVNSQITKILD 77
Database: celegans
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 12,573,161
Number of sequences in database: 27,539
Lambda K H
0.315 0.128 0.392
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,545,424
Number of Sequences: 27539
Number of extensions: 472483
Number of successful extensions: 1114
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1114
Number of HSP's gapped (non-prelim): 1
length of query: 779
length of database: 12,573,161
effective HSP length: 87
effective length of query: 692
effective length of database: 10,177,268
effective search space: 7042669456
effective search space used: 7042669456
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 63 (29.5 bits)
- SilkBase 1999-2023 -