BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000378-TA|BGIBMGA000378-PA|IPR000697|EVH1 (779 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73898-5|CAI46588.1| 124|Caenorhabditis elegans Hypothetical pr... 31 3.1 >Z73898-5|CAI46588.1| 124|Caenorhabditis elegans Hypothetical protein ZK822.6 protein. Length = 124 Score = 31.1 bits (67), Expect = 3.1 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Query: 39 WAEVFHVSASGAGTVKWQQVSEDLVPVNITCIQDSPECVFHITAYNSQVDKILD 92 WAE + V++ A K Q+VS+ + NIT + + +++ NSQ+ KILD Sbjct: 30 WAETYKVTSQYAQYQKDQKVSKAQMESNIT------QLISKLSSVNSQITKILD 77 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.315 0.128 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,545,424 Number of Sequences: 27539 Number of extensions: 472483 Number of successful extensions: 1114 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1114 Number of HSP's gapped (non-prelim): 1 length of query: 779 length of database: 12,573,161 effective HSP length: 87 effective length of query: 692 effective length of database: 10,177,268 effective search space: 7042669456 effective search space used: 7042669456 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -