BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000377-TA|BGIBMGA000377-PA|IPR011129|Cold shock protein, IPR001878|Zinc finger, CCHC-type, IPR002059|Cold-shock protein, DNA-binding, IPR008994|Nucleic acid-binding, OB-fold (154 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 4.2 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 4.2 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Query: 2 VKRRGRCKWFNVAKGWGFITPDDGGQDVFVHQS 34 ++R RC N+ F+T DG DV HQS Sbjct: 156 LERAFRCLGNNLT---AFLTTLDGVNDVVQHQS 185 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.139 0.459 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,797 Number of Sequences: 429 Number of extensions: 1591 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 154 length of database: 140,377 effective HSP length: 53 effective length of query: 101 effective length of database: 117,640 effective search space: 11881640 effective search space used: 11881640 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.3 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -