BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000375-TA|BGIBMGA000375-PA|IPR001269|Dihydrouridine synthase, DuS (222 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 22 4.4 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 7.7 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/36 (33%), Positives = 16/36 (44%) Query: 133 IVKGLRNVLPNKFSISVKIRLLNDIKKTVILCQQLE 168 IV L+ N F + + NDI +ILC E Sbjct: 91 IVTILKKTKSNIFILKESVDTFNDIFGWIILCNIFE 126 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.0 bits (42), Expect = 7.7 Identities = 12/48 (25%), Positives = 22/48 (45%) Query: 72 TTDFPVIAQFAANNRDDFVDASKLVYPYVDGVDLNCGCPQKWAMKDGY 119 T + + +F N ++ D K+ Y Y D + + P+ A+K Y Sbjct: 290 TLGYNELCEFHKNGIIEWDDTQKVPYLYDDTLWVGFDNPKSVALKAQY 337 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.136 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,458 Number of Sequences: 317 Number of extensions: 1997 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 222 length of database: 114,650 effective HSP length: 54 effective length of query: 168 effective length of database: 97,532 effective search space: 16385376 effective search space used: 16385376 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -