BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000371-TA|BGIBMGA000371-PA|IPR000618|Insect cuticle protein (303 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 25 0.91 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.9 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 24.6 bits (51), Expect = 0.91 Identities = 13/53 (24%), Positives = 19/53 (35%) Query: 152 SKPSSSTVKPFTITPSQNERISLLPVQENQRNINKRTRERDPVVPIIESENYI 204 S PS+ KP TP + + QR T E P + +N + Sbjct: 417 STPSADGSKPVQTTPKPGQWVPEKSTSTTQRTTTVSTTEAPPAPAVSNPQNEV 469 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 184 INKRTRERDPVVPIIESENYIYSHKGNFHYS 214 +N RTR P+VP E + S+ H S Sbjct: 1482 LNPRTRGEKPIVPSAEKFIEVSSNSITLHLS 1512 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 4 LFCLLVVTSLASSDNSSQDEGFRT 27 LFC+LV + A + D+G RT Sbjct: 6 LFCVLVTLATARNKAPLLDDGTRT 29 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.130 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,545 Number of Sequences: 317 Number of extensions: 2784 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 303 length of database: 114,650 effective HSP length: 57 effective length of query: 246 effective length of database: 96,581 effective search space: 23758926 effective search space used: 23758926 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -