BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000371-TA|BGIBMGA000371-PA|IPR000618|Insect cuticle protein (303 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 33 0.010 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 29 0.21 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 28 0.28 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 28 0.28 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 28 0.28 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 28 0.28 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 28 0.28 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 28 0.28 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 28 0.28 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 28 0.28 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 28 0.28 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 28 0.28 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 28 0.28 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 28 0.37 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 24 6.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 6.1 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 23 8.1 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 23 8.1 AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. 23 8.1 AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. 23 8.1 AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. 23 8.1 AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. 23 8.1 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 23 8.1 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 8.1 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 33.1 bits (72), Expect = 0.010 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 227 GELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTAD-ENGYRPV 269 G+ + + G+ V GS+S D DG ++ YTAD NG+ V Sbjct: 35 GDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAV 78 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 28.7 bits (61), Expect = 0.21 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 83 NYEFSYSVHDE----HTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 269 V 269 V Sbjct: 139 V 139 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 91 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 269 V 269 V Sbjct: 147 V 147 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 83 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 269 V 269 V Sbjct: 139 V 139 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 83 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 269 V 269 V Sbjct: 139 V 139 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 83 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 269 V 269 V Sbjct: 139 V 139 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 83 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 269 V 269 V Sbjct: 139 V 139 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 91 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 269 V 269 V Sbjct: 147 V 147 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 115 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 170 Query: 269 V 269 V Sbjct: 171 V 171 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 83 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 269 V 269 V Sbjct: 139 V 139 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 91 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 269 V 269 V Sbjct: 147 V 147 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 83 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 269 V 269 V Sbjct: 139 V 139 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 28.3 bits (60), Expect = 0.28 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 91 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 269 V 269 V Sbjct: 147 V 147 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.9 bits (59), Expect = 0.37 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 210 NFHYSYEGGDGTKAFEQGELRRFDDDTAGETVSGSFSYKDRDGNDFSLSYTADEN-GYRP 268 N+ +SY D G+++ + G+ V G +S D DG+ + Y AD + G+ Sbjct: 91 NYEFSYSVHDE----HTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNA 146 Query: 269 V 269 V Sbjct: 147 V 147 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Query: 146 TIGPLKSKPSSSTVKPFTITP 166 T+ P KS +++TVKP T TP Sbjct: 120 TVAP-KSTTTTTTVKPTTTTP 139 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 6.1 Identities = 14/42 (33%), Positives = 23/42 (54%) Query: 107 VQSVTVANAFKVQVDDTIVGKNRIVTRKPSKGRRRQQQETIG 148 V+ V AF + DT+V +N ++ + GR+R + TIG Sbjct: 688 VEDQRVLPAFYFALRDTLVAENLDQGQRIAYGRQRFRVVTIG 729 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.4 bits (48), Expect = 8.1 Identities = 21/93 (22%), Positives = 37/93 (39%), Gaps = 4/93 (4%) Query: 114 NAFKVQVDDTIVGKNRIVTRKPSKGRRRQQQETIGP-LKSKPSSSTVKPFTITPSQNERI 172 + FK D +V K V+ K G+ + ++S ++ + QN + Sbjct: 16 DVFKFPTDRDLVRKAFDVSLKRLSGQNPTDEPQFKTWFYIYKNNSVLQAYKDVLEQNYAV 75 Query: 173 SLLPVQENQRNINKRTRERDPVV---PIIESEN 202 + ++ N N ++ DPVV IIE N Sbjct: 76 EVRDIERNDYNFDEPKTSLDPVVVEEEIIEESN 108 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 23.4 bits (48), Expect = 8.1 Identities = 6/17 (35%), Positives = 12/17 (70%) Query: 194 VVPIIESENYIYSHKGN 210 +VP+ + Y+Y+H+ N Sbjct: 222 IVPVANPDGYVYTHEQN 238 >AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/40 (25%), Positives = 18/40 (45%) Query: 22 DEGFRTIAAYNFNHPPNVDYNPLPVDVVYEQKKLEEKSSD 61 DE AA N PPN+D + + + ++ + + D Sbjct: 135 DEALTLFAAVNRTAPPNIDIDKIKKEANQYNREADRIAED 174 >AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/40 (25%), Positives = 18/40 (45%) Query: 22 DEGFRTIAAYNFNHPPNVDYNPLPVDVVYEQKKLEEKSSD 61 DE AA N PPN+D + + + ++ + + D Sbjct: 135 DEALTLFAAVNRTAPPNIDIDKIKKEANQYNREADRIAED 174 >AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/40 (25%), Positives = 18/40 (45%) Query: 22 DEGFRTIAAYNFNHPPNVDYNPLPVDVVYEQKKLEEKSSD 61 DE AA N PPN+D + + + ++ + + D Sbjct: 135 DEALTLFAAVNRTAPPNIDIDKIKKEANQYNREADRIAED 174 >AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/40 (25%), Positives = 18/40 (45%) Query: 22 DEGFRTIAAYNFNHPPNVDYNPLPVDVVYEQKKLEEKSSD 61 DE AA N PPN+D + + + ++ + + D Sbjct: 135 DEALTLFAAVNRTAPPNIDIDKIKKEANQYNREADRIAED 174 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 23.4 bits (48), Expect = 8.1 Identities = 6/17 (35%), Positives = 12/17 (70%) Query: 194 VVPIIESENYIYSHKGN 210 +VP+ + Y+Y+H+ N Sbjct: 222 IVPVANPDGYVYTHEQN 238 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/40 (25%), Positives = 18/40 (45%) Query: 22 DEGFRTIAAYNFNHPPNVDYNPLPVDVVYEQKKLEEKSSD 61 DE AA N PPN+D + + + ++ + + D Sbjct: 1274 DEALTLFAAVNRTAPPNIDIDKIKKEANQYNREADRIAED 1313 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.311 0.130 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 290,312 Number of Sequences: 2123 Number of extensions: 12434 Number of successful extensions: 33 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 24 length of query: 303 length of database: 516,269 effective HSP length: 64 effective length of query: 239 effective length of database: 380,397 effective search space: 90914883 effective search space used: 90914883 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -