BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000367-TA|BGIBMGA000367-PA|IPR000504|RNA-binding region RNP-1 (RNA recognition motif), IPR012677|Nucleotide-binding, alpha-beta plait (274 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 3.3 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 5.7 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 21 VLPPPSEVVENGLKIVTEYKYDNDNKKVKI 50 VL +++ + GLK V+ K N N KV + Sbjct: 70 VLDEENDINQGGLKRVSALKEKNPNLKVML 99 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 67 KRKTWSKFGDSASDKPGPNPATTNVAED 94 KRKTW DS S +P + + D Sbjct: 105 KRKTWKVEEDSPSPTSSVSPEVKDSSRD 132 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.133 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,395 Number of Sequences: 317 Number of extensions: 2679 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 274 length of database: 114,650 effective HSP length: 56 effective length of query: 218 effective length of database: 96,898 effective search space: 21123764 effective search space used: 21123764 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -