BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000361-TA|BGIBMGA000361-PA|IPR009057|Homeodomain-like (243 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 24 0.93 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 22 4.9 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 24.2 bits (50), Expect = 0.93 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 203 KELATVRHLASQRSYNPLNIPEEFLKPSLCIKSKE 237 K L ++++ SQ + P PE+ + + CI K+ Sbjct: 444 KYLPVLKNMPSQYIHEPWTAPEQVQRAAKCIIGKD 478 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 50 PEEIIHAIDYYKNLALLEVKPL 71 PE++ DYYK++ L +K L Sbjct: 214 PEDVPGCEDYYKDVDLKALKKL 235 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.133 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,083 Number of Sequences: 317 Number of extensions: 2552 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 243 length of database: 114,650 effective HSP length: 55 effective length of query: 188 effective length of database: 97,215 effective search space: 18276420 effective search space used: 18276420 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -