BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000359-TA|BGIBMGA000359-PA|undefined (807 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 27 0.39 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 26 0.89 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 4.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 4.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 4.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 4.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 24 4.7 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 27.5 bits (58), Expect = 0.39 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Query: 110 VRHTRHDQFPVIPDEIYSMYENGSYYSVTSP 140 +RH H Q+ PD + Y N +YY++ P Sbjct: 70 IRH--HGQWNYSPDNHFEQYPNPTYYNLADP 98 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 26.2 bits (55), Expect = 0.89 Identities = 10/25 (40%), Positives = 19/25 (76%), Gaps = 2/25 (8%) Query: 775 DTSFECFSSEPAAILARHGAPPSPV 799 +TSFE S +P+ +++ + +PPSP+ Sbjct: 116 ETSFE--SGKPSGVISTNTSPPSPI 138 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 362 PHLSESAASCSSEIDDLSWLLSDTNLRSKP 391 PH++E S +S ID+ + + T +R +P Sbjct: 56 PHVNEYVESLASIIDEAATKVHGTTVRVRP 85 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 362 PHLSESAASCSSEIDDLSWLLSDTNLRSKP 391 PH++E S +S ID+ + + T +R +P Sbjct: 370 PHVNEYVESLASIIDEAATKVHGTTVRVRP 399 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 362 PHLSESAASCSSEIDDLSWLLSDTNLRSKP 391 PH++E S +S ID+ + + T +R +P Sbjct: 603 PHVNEYVESLASIIDEAATKVHGTTVRVRP 632 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 362 PHLSESAASCSSEIDDLSWLLSDTNLRSKP 391 PH++E S +S ID+ + + T +R +P Sbjct: 603 PHVNEYVESLASIIDEAATKVHGTTVRVRP 632 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.8 bits (49), Expect = 4.7 Identities = 14/43 (32%), Positives = 18/43 (41%) Query: 311 TKGTIANQRPKIPELQRRTSTSSFSGPEVTNSPPTQMDMTGYA 353 T+ T+ N R +QR S S P V N P T Y+ Sbjct: 256 TRTTLKNNRASPYPMQRPKSASLSPPPHVYNPPDHIQQATPYS 298 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.129 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,119 Number of Sequences: 317 Number of extensions: 6378 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 7 length of query: 807 length of database: 114,650 effective HSP length: 62 effective length of query: 745 effective length of database: 94,996 effective search space: 70772020 effective search space used: 70772020 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -