BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000359-TA|BGIBMGA000359-PA|undefined
(807 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 7.9
>AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1
chain protein.
Length = 1024
Score = 25.0 bits (52), Expect = 7.9
Identities = 13/40 (32%), Positives = 19/40 (47%)
Query: 106 GWLCVRHTRHDQFPVIPDEIYSMYENGSYYSVTSPDYRAN 145
G L VRH++ D+ PV +++ S V DY N
Sbjct: 802 GILLVRHSQSDEVPVCEPGHLKLWDGYSLLYVDGNDYPHN 841
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.315 0.129 0.371
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 741,022
Number of Sequences: 2123
Number of extensions: 27819
Number of successful extensions: 63
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 62
Number of HSP's gapped (non-prelim): 1
length of query: 807
length of database: 516,269
effective HSP length: 70
effective length of query: 737
effective length of database: 367,659
effective search space: 270964683
effective search space used: 270964683
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 52 (25.0 bits)
- SilkBase 1999-2023 -