BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000359-TA|BGIBMGA000359-PA|undefined (807 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 7.9 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.0 bits (52), Expect = 7.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Query: 106 GWLCVRHTRHDQFPVIPDEIYSMYENGSYYSVTSPDYRAN 145 G L VRH++ D+ PV +++ S V DY N Sbjct: 802 GILLVRHSQSDEVPVCEPGHLKLWDGYSLLYVDGNDYPHN 841 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.129 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 741,022 Number of Sequences: 2123 Number of extensions: 27819 Number of successful extensions: 63 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 62 Number of HSP's gapped (non-prelim): 1 length of query: 807 length of database: 516,269 effective HSP length: 70 effective length of query: 737 effective length of database: 367,659 effective search space: 270964683 effective search space used: 270964683 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -