BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000356-TA|BGIBMGA000356-PA|undefined (189 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.04c |||DUF89 family protein|Schizosaccharomyces pombe|ch... 29 0.43 SPCC4G3.10c |rhp42|rhp4b|DNA repair protein Rhp42|Schizosaccharo... 25 7.0 SPAC9E9.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 25 7.0 SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom... 25 7.0 SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom... 25 7.0 SPBP23A10.06 |||manganese ion transporter |Schizosaccharomyces p... 25 9.3 >SPAC806.04c |||DUF89 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 29.1 bits (62), Expect = 0.43 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Query: 133 NEEVLAQERIIMKDLLLRIQGIIKDDKPLNPFEGP-QAHLAFEQAVKALES 182 + EV+AQ + ++ DL + IK+D+PL P EG Q + + + +K L++ Sbjct: 52 DSEVVAQGKPLLNDLEA-FKSDIKNDRPLVPLEGEGQDIVEYNEELKQLDN 101 >SPCC4G3.10c |rhp42|rhp4b|DNA repair protein Rhp42|Schizosaccharomyces pombe|chr 3|||Manual Length = 686 Score = 25.0 bits (52), Expect = 7.0 Identities = 9/44 (20%), Positives = 22/44 (50%) Query: 12 EDFHSDTDIVNESEKPLKLEKHKKGILKHEKGIEIEYKICKKPI 55 E++H + ++ E E+P K+ K + + ++ E +P+ Sbjct: 505 ENYHKEGRVIKEGEQPRKMVKARAVTISRKREHEFRVAETNEPV 548 >SPAC9E9.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 313 Score = 25.0 bits (52), Expect = 7.0 Identities = 25/107 (23%), Positives = 38/107 (35%), Gaps = 1/107 (0%) Query: 22 NESEKPLKLEKHKKGILKHEKGIEIEYKICKKPIKPKVLKNVVLLQSDPDVVKKRSHKIR 81 +ES P+ L L+ K KP+ K L+ ++ + + + R + R Sbjct: 138 SESSSPIPLSLLSTSSLQQRKITPSNLSNTSKPMDSKQLERLIPVPHGHHLTRLRKKRRR 197 Query: 82 QDICPYCGKI-TKSLKAHALICTQPYSYKHDFNRHCFKKHGVFLKRR 127 D G TKS A+ + SY R K KRR Sbjct: 198 DDDIDLSGLYETKSSSPPAIHSDEDPSYSDSIARSPVKSAFNLRKRR 244 >SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pombe|chr 1||Partial|Manual Length = 1887 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 4 QRNEDSGAEDFHSDTDIVNESEKPLKLEKHKKGILKHE 41 QRNE + ++D N+++ LKL K I K+E Sbjct: 820 QRNECDNYSNHYNDNSNDNDNDVFLKLHWSKSAIKKYE 857 >SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 4 QRNEDSGAEDFHSDTDIVNESEKPLKLEKHKKGILKHE 41 QRNE + ++D N+++ LKL K I K+E Sbjct: 820 QRNECDNYSNHYNDNSNDNDNDVFLKLHWSKSAIKKYE 857 >SPBP23A10.06 |||manganese ion transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 335 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Query: 19 DIVNESEKPLKLEKHKKGILKHEKGIEI 46 +I NE LKL H+KGIL G+ + Sbjct: 178 EIANEVFDGLKLMIHQKGILNLWSGVSV 205 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.137 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 915,615 Number of Sequences: 5004 Number of extensions: 38671 Number of successful extensions: 118 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 114 Number of HSP's gapped (non-prelim): 6 length of query: 189 length of database: 2,362,478 effective HSP length: 69 effective length of query: 120 effective length of database: 2,017,202 effective search space: 242064240 effective search space used: 242064240 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -