BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000355-TA|BGIBMGA000355-PA|IPR002853|Transcription factor TFIIE, alpha subunit (421 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 27 0.25 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 26 0.58 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 24 2.3 L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protei... 23 3.1 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 23 3.1 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 23 5.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 5.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 5.4 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 22 7.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 7.1 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 27.1 bits (57), Expect = 0.25 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 102 VVKYKLDLMRKRLETEERDATSRASFKCPACGKTFT 137 V+ +++ + L+ R T FKC CG+ FT Sbjct: 138 VICHRVLSCKSALQMHYRTHTGERPFKCKICGRAFT 173 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 25.8 bits (54), Expect = 0.58 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Query: 114 LETEERDATSRASFKCPACGKTFT---DLEADQLYDMATQEFQCTFC 157 L+ ER T F+C C K FT L+ + ++C C Sbjct: 150 LQNHERTHTGEKPFECQECHKRFTRDHHLKTHMRLHTGERPYRCEHC 196 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.8 bits (49), Expect = 2.3 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Query: 48 ICELLKFERKMLRARISILKNDKFIQVRLKMETGLDGKAQKVNYYFINYK 97 IC KF+ M+ R S L ND F + L + + + A + + YK Sbjct: 472 ICVAYKFDAAMMALRTSFLVND-FGFIWLVLSSTVRAYASRAFKKIVTYK 520 >L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protein protein. Length = 74 Score = 23.4 bits (48), Expect = 3.1 Identities = 12/43 (27%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Query: 118 ERDATSRASFKCPACGKTFT---DLEADQLYDMATQEFQCTFC 157 ER T F+C C K FT L+ + ++C C Sbjct: 1 ERTHTGEKPFECQECHKRFTRDHHLKTHMRLHTGERPYRCEHC 43 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 23.4 bits (48), Expect = 3.1 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 111 RKRLETEERDATSRASFKCPACGKTFTDLE-ADQLYD 146 RK + E RD A+ +CP F D E D+ Y+ Sbjct: 21 RKHQKQESRDEEYEATDQCPEKYGFFADAEQCDKYYE 57 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 22.6 bits (46), Expect = 5.4 Identities = 8/19 (42%), Positives = 9/19 (47%) Query: 118 ERDATSRASFKCPACGKTF 136 ER T + C CGK F Sbjct: 99 ERTHTDERPYSCDICGKAF 117 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 105 YKLDLMRKRLETEERDATSRASFKCPACGKTFTDLE 140 Y + +M K + +F+ P+C +TF LE Sbjct: 229 YTVQIMAKSESSPFESLKKSLNFRTPSCLETFHTLE 264 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 5.4 Identities = 9/23 (39%), Positives = 10/23 (43%) Query: 114 LETEERDATSRASFKCPACGKTF 136 L+ R T F CP C K F Sbjct: 362 LQRHLRTHTGEKRFACPICNKRF 384 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 22.2 bits (45), Expect = 7.1 Identities = 13/60 (21%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Query: 114 LETEERDATSRASFKCPACGKTFTDLEADQLY---DMATQEFQCTFCSAVVDEDMSALPK 170 L R + F+CP C + F+ + + + ++C C D S L K Sbjct: 37 LTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAF-SDSSTLTK 95 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 7.1 Identities = 13/60 (21%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Query: 114 LETEERDATSRASFKCPACGKTFTDLEADQLY---DMATQEFQCTFCSAVVDEDMSALPK 170 L R + F+CP C + F+ + + + ++C C D S L K Sbjct: 293 LTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAF-SDSSTLTK 351 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.132 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,014 Number of Sequences: 317 Number of extensions: 2890 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 11 length of query: 421 length of database: 114,650 effective HSP length: 59 effective length of query: 362 effective length of database: 95,947 effective search space: 34732814 effective search space used: 34732814 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -