BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000352-TA|BGIBMGA000352-PA|IPR001873|Na+ channel, amiloride-sensitive (453 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.07 |alp14|mtc1|Mad2-dependent spindle checkpoint compone... 33 0.11 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 30 0.58 SPAC3H5.04 |aar2||U5 snRNP-associated protein Aar2|Schizosacchar... 27 4.1 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 27 7.1 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 27 7.1 >SPCC895.07 |alp14|mtc1|Mad2-dependent spindle checkpoint component |Schizosaccharomyces pombe|chr 3|||Manual Length = 809 Score = 32.7 bits (71), Expect = 0.11 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 15/133 (11%) Query: 4 SGLDTDFHNWDV-PFPAVTICDASPVDDELLQEYIESVWGSDPPERAAEMLQWLATLSYS 62 S L + + W P + D PV + L+ + ++PP++ ++L + + Sbjct: 192 SRLTVNIYRWTGDPLKDLLFKDLRPVQTKELESLFAEL-PTEPPKQT----RFLKSQQPT 246 Query: 63 SIAEHAAEYLAEPGLVGENENNVPEPARDSKEAVFK------VVRHCETLFYDCVWKGDS 116 S + +P L ENE + PEP+ D + V + V + ETL WK D Sbjct: 247 SEPNVETQVEEQPAL--ENEESEPEPSDDQFDLVEEVDVLPNVDPNLETLMASSKWK-DR 303 Query: 117 EECCDLLIPVFTE 129 +E D L+PV ++ Sbjct: 304 KEALDKLLPVLSQ 316 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 30.3 bits (65), Expect = 0.58 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 406 PKPPHNLSLIPWWKEPPIPGSVRPILVRAKDSMPPQYSPPPGYTTYLP 453 P PP + S W + P+ G + + RA SM P SP PG ++ P Sbjct: 850 PLPPPSTSTTAGWNDAPMLGQLP--MRRAAPSMAPVRSPFPGASSAQP 895 >SPAC3H5.04 |aar2||U5 snRNP-associated protein Aar2|Schizosaccharomyces pombe|chr 1|||Manual Length = 346 Score = 27.5 bits (58), Expect = 4.1 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Query: 32 LLQEYIESVWGSDPPERAAEMLQWLATLSYSSIAEHAA 69 L Q ++SVW +P AE+ ++ LSYS ++ + A Sbjct: 178 LFQRLVQSVWNDNPISALAELS--ISFLSYSILSHYGA 213 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 26.6 bits (56), Expect = 7.1 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Query: 404 AQPKPPHNLSLIPWWKEPPIPGSVRPILVRAKDSMPPQYSPPPGYTTY 451 AQP PP P PP S P + + + PPQ +P P Y Sbjct: 204 AQPPPPP-----PQQNYPPAASSSAPPMQYQQTAYPPQQAPYPPVQAY 246 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/50 (20%), Positives = 26/50 (52%) Query: 182 DIYIHSTEEMAGLEQSAQHSWDYRVEKVSFSVKHTYTTDDARQLSIRQRR 231 D+++ +AGL+++ ++ +E F + T +T D+ ++ Q + Sbjct: 1231 DVHVKVNAVLAGLQKNDPSAYSNMLEATHFELSTTSSTSDSNEIEKTQEK 1280 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.134 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,132,332 Number of Sequences: 5004 Number of extensions: 87070 Number of successful extensions: 174 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 173 Number of HSP's gapped (non-prelim): 5 length of query: 453 length of database: 2,362,478 effective HSP length: 75 effective length of query: 378 effective length of database: 1,987,178 effective search space: 751153284 effective search space used: 751153284 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -