SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000350-TA|BGIBMGA000350-PA|undefined
         (142 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_34688| Best HMM Match : Zip (HMM E-Value=9.8e-08)                   27   7.9  

>SB_34688| Best HMM Match : Zip (HMM E-Value=9.8e-08)
          Length = 218

 Score = 26.6 bits (56), Expect = 7.9
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 60  FSWAFLGGCLWPLGSIFLWAILRSSVGQRPVIGTIIGVTTGAMLTNIALD 109
           F  + L G   P+G+   + +L SSV    V G + GV  G M+  +A+D
Sbjct: 136 FIASLLSGLAEPVGAAIGYGLL-SSVLSEAVFGAVFGVIAGVMVF-LAID 183


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.326    0.141    0.461 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,830,787
Number of Sequences: 59808
Number of extensions: 178603
Number of successful extensions: 312
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 312
Number of HSP's gapped (non-prelim): 1
length of query: 142
length of database: 16,821,457
effective HSP length: 75
effective length of query: 67
effective length of database: 12,335,857
effective search space: 826502419
effective search space used: 826502419
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 56 (26.6 bits)

- SilkBase 1999-2023 -