BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000350-TA|BGIBMGA000350-PA|undefined (142 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 0.79 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 23 1.0 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 23 1.0 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 22 2.4 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 22 2.4 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 22 2.4 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 0.79 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 102 MLTNIALDYFHYIELMFC 119 +L + + YF+Y+ L+FC Sbjct: 252 LLLLVCIYYFYYMHLLFC 269 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.0 bits (47), Expect = 1.0 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Query: 70 WPLGSIFL--WAILRSSVGQRPVIGTIIGV-TTGAML 103 W + L WA++ + Q + TI+G T G M+ Sbjct: 219 WSMSGTMLVPWALMEQPLAQTKKLATIVGCGTDGTMI 255 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.0 bits (47), Expect = 1.0 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Query: 70 WPLGSIFL--WAILRSSVGQRPVIGTIIGV-TTGAML 103 W + L WA++ + Q + TI+G T G M+ Sbjct: 219 WSMSGTMLVPWALMEQPLAQTKKLATIVGCGTDGTMI 255 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 2.4 Identities = 9/32 (28%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Query: 70 WPLGSIFL--WAILRSSVGQRPVIGTIIGVTT 99 W + L WA++ + Q + TI+G T Sbjct: 219 WSMSGTMLVPWALMEQPLAQTKKLATIVGCGT 250 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 2.4 Identities = 9/32 (28%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Query: 70 WPLGSIFL--WAILRSSVGQRPVIGTIIGVTT 99 W + L WA++ + Q + TI+G T Sbjct: 219 WSMSGTMLVPWALMEQPLAQTKKLATIVGCGT 250 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 2.4 Identities = 9/32 (28%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Query: 70 WPLGSIFL--WAILRSSVGQRPVIGTIIGVTT 99 W + L WA++ + Q + TI+G T Sbjct: 219 WSMSGTMLVPWALMEQPLAQTKKLATIVGCGT 250 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.141 0.461 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,876 Number of Sequences: 317 Number of extensions: 1373 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 142 length of database: 114,650 effective HSP length: 51 effective length of query: 91 effective length of database: 98,483 effective search space: 8961953 effective search space used: 8961953 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.2 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -