BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000350-TA|BGIBMGA000350-PA|undefined (142 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 22 8.9 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 21.8 bits (44), Expect = 8.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 61 SWAFLGGCLWPLGSIFLWAILRSSVGQRPVIGTIIG 96 S FLGG ++L ++ +G RPV+ I G Sbjct: 87 SGGFLGGVSGSEDCLYLNVYTQNLIGSRPVMVWIHG 122 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.141 0.461 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,758 Number of Sequences: 2123 Number of extensions: 5822 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 1 length of query: 142 length of database: 516,269 effective HSP length: 58 effective length of query: 84 effective length of database: 393,135 effective search space: 33023340 effective search space used: 33023340 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -