BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000349-TA|BGIBMGA000349-PA|IPR000905|Peptidase M22, glycoprotease, IPR009180|Peptidase M22, O-sialoglycoprotein endopeptidase (408 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 3.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 5.2 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.4 bits (48), Expect = 3.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 347 CTDNGIMIAWNGLEKWRKNLDIMTNFNTLDLE 378 C +G + W G RK + F TL+LE Sbjct: 228 CGTSGNPLEWTGQVTVRKKRKPYSKFQTLELE 259 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 5.2 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 63 LRNGGIIPDVAQDLHRKYIEPTVTETLLKANLLMKDISAIAVTVKPGLPLS 113 +RN II + D+ R + ++ N+L+K++ + KPG P S Sbjct: 646 VRNTSIIK-IPFDVFRNMLPVRNVSVDVRDNILLKNLQNPSTGSKPGKPRS 695 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.135 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,530 Number of Sequences: 317 Number of extensions: 3450 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 408 length of database: 114,650 effective HSP length: 58 effective length of query: 350 effective length of database: 96,264 effective search space: 33692400 effective search space used: 33692400 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -