BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000344-TA|BGIBMGA000344-PA|undefined (104 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 1.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 1.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 1.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 1.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 1.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 1.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 1.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 1.9 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 2.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 19 7.9 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 19 7.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 19 7.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 19 7.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 19 7.9 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 150 STSPPGKPATSTTSQNLSSPASSTSSTSSTEKAGTNNNN 188 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNN 188 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNN 188 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNN 188 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNN 188 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 106 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNN 144 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNN 188 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 1.9 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 13 SVIQPNKPATKPKAVAMDTFPFSDKVTDENEKGNQNDTS 51 S P KPAT + + + S T EK N+ + Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNN 188 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 2.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 24 PKAVAMDTFPFSDKVTDENEKGNQNDTSLNLSDI 57 PK MD S + D++E N D NL+ + Sbjct: 4 PKLSQMDISENSTYLFDKHEDRNNTDRDENLARV 37 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.4 bits (38), Expect = 7.9 Identities = 8/37 (21%), Positives = 15/37 (40%) Query: 57 IPEKNKEISTENTYDTSTDSGFTTSIYYDDELFNRSG 93 +P+K +T T T + Y+ + + R G Sbjct: 2300 VPDKPVTTTTSRPIGTDTSDDYKVVCYFTNWAWYRQG 2336 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 19.4 bits (38), Expect = 7.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 56 DIPEKNKEISTENTYDTSTD 75 ++ +KEI ENTY + D Sbjct: 142 ELSAHSKEIRGENTYILALD 161 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 19.4 bits (38), Expect = 7.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 56 DIPEKNKEISTENTYDTSTD 75 ++ +KEI ENTY + D Sbjct: 456 ELSAHSKEIRGENTYILALD 475 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 19.4 bits (38), Expect = 7.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 56 DIPEKNKEISTENTYDTSTD 75 ++ +KEI ENTY + D Sbjct: 689 ELSAHSKEIRGENTYILALD 708 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 19.4 bits (38), Expect = 7.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 56 DIPEKNKEISTENTYDTSTD 75 ++ +KEI ENTY + D Sbjct: 689 ELSAHSKEIRGENTYILALD 708 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.307 0.126 0.347 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,693 Number of Sequences: 317 Number of extensions: 1132 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of query: 104 length of database: 114,650 effective HSP length: 49 effective length of query: 55 effective length of database: 99,117 effective search space: 5451435 effective search space used: 5451435 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (19.8 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -