BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000343-TA|BGIBMGA000343-PA|IPR000618|Insect cuticle protein (118 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X77748-1|CAA54796.1| 877|Homo sapiens metabotropic glutamate re... 32 0.53 BC041407-1|AAH41407.1| 879|Homo sapiens glutamate receptor, met... 32 0.53 BC014077-1|AAH14077.2| 724|Homo sapiens GRAM domain containing ... 29 3.7 AK074914-1|BAC11289.1| 713|Homo sapiens protein ( Homo sapiens ... 29 3.7 AC002081-1|AAC60379.2| 437|Homo sapiens unknown protein. 29 3.7 AB040966-1|BAA96057.1| 651|Homo sapiens KIAA1533 protein protein. 29 3.7 BC022496-1|AAH22496.2| 879|Homo sapiens glutamate receptor, met... 29 4.9 >X77748-1|CAA54796.1| 877|Homo sapiens metabotropic glutamate receptor type 3 (mGluR3) protein. Length = 877 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 11 LALAHSAPQGPKDDNVQLLKFDSDNDGLGSYRFLYEQTDGSK 52 L + +AP P D ++KFD+ DG+G Y Q G K Sbjct: 434 LKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGK 475 >BC041407-1|AAH41407.1| 879|Homo sapiens glutamate receptor, metabotropic 3 protein. Length = 879 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 11 LALAHSAPQGPKDDNVQLLKFDSDNDGLGSYRFLYEQTDGSK 52 L + +AP P D ++KFD+ DG+G Y Q G K Sbjct: 436 LKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGK 477 >BC014077-1|AAH14077.2| 724|Homo sapiens GRAM domain containing 1A protein. Length = 724 Score = 29.1 bits (62), Expect = 3.7 Identities = 9/17 (52%), Positives = 15/17 (88%) Query: 97 QPSIEQGPGGAIPSSVI 113 +PS++QGPG IPS+++ Sbjct: 593 EPSVDQGPGAGIPSALV 609 >AK074914-1|BAC11289.1| 713|Homo sapiens protein ( Homo sapiens cDNA FLJ90433 fis, clone NT2RP3000721. ). Length = 713 Score = 29.1 bits (62), Expect = 3.7 Identities = 9/17 (52%), Positives = 15/17 (88%) Query: 97 QPSIEQGPGGAIPSSVI 113 +PS++QGPG IPS+++ Sbjct: 586 EPSVDQGPGAGIPSALV 602 >AC002081-1|AAC60379.2| 437|Homo sapiens unknown protein. Length = 437 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Query: 18 PQGPKDDNVQLLKFDSDNDGLGSYRFLYEQTDGSK 52 P P D ++KFD+ DG+G Y Q G K Sbjct: 1 PFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGK 35 >AB040966-1|BAA96057.1| 651|Homo sapiens KIAA1533 protein protein. Length = 651 Score = 29.1 bits (62), Expect = 3.7 Identities = 9/17 (52%), Positives = 15/17 (88%) Query: 97 QPSIEQGPGGAIPSSVI 113 +PS++QGPG IPS+++ Sbjct: 523 EPSVDQGPGAGIPSALV 539 >BC022496-1|AAH22496.2| 879|Homo sapiens glutamate receptor, metabotropic 3 protein. Length = 879 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/42 (33%), Positives = 20/42 (47%) Query: 11 LALAHSAPQGPKDDNVQLLKFDSDNDGLGSYRFLYEQTDGSK 52 L + +AP D ++KFD+ DG+G Y Q G K Sbjct: 436 LKINFTAPFNTNKDADSIVKFDTFGDGMGRYNVFNFQNVGGK 477 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.314 0.136 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,696,713 Number of Sequences: 224733 Number of extensions: 805269 Number of successful extensions: 920 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 913 Number of HSP's gapped (non-prelim): 7 length of query: 118 length of database: 73,234,838 effective HSP length: 80 effective length of query: 38 effective length of database: 55,256,198 effective search space: 2099735524 effective search space used: 2099735524 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -