BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000343-TA|BGIBMGA000343-PA|IPR000618|Insect cuticle protein (118 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 48 3e-08 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 2.8 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 2.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 2.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 3.8 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 20 8.7 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 20 8.7 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 20 8.7 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 20 8.7 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 20 8.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 20 8.7 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 48.0 bits (109), Expect = 3e-08 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Query: 14 AHSAPQGPKDDNVQLLKFDSDNDGLGSYRFLYEQTDGSKRDEQGEVINVGTDDESIVIKG 73 A P G D + + + + G+Y +E ++G E G+ V ++ +V +G Sbjct: 15 APQRPSGGADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVD-NETPVVSQG 73 Query: 74 SYSWVAPDGITYTVTYVADDKGFQ 97 S S+ APDG ++TYVAD+ GFQ Sbjct: 74 SDSYTAPDGQQVSITYVADENGFQ 97 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 2.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Query: 29 LKFDSDNDGLGSYRFL 44 +KFD DGL Y L Sbjct: 388 VKFDEHGDGLARYEIL 403 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 2.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Query: 86 TVTYVADDKG 95 T+ Y+ADDKG Sbjct: 202 TIVYMADDKG 211 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 2.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Query: 29 LKFDSDNDGLGSYRFL 44 +KFD DGL Y L Sbjct: 478 VKFDEHGDGLARYEIL 493 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 3.8 Identities = 7/12 (58%), Positives = 10/12 (83%) Query: 84 TYTVTYVADDKG 95 T T+ Y+AD+KG Sbjct: 202 TNTMVYIADEKG 213 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 19.8 bits (39), Expect = 8.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Query: 86 TVTYVADDKG 95 T+ Y+AD+KG Sbjct: 201 TMVYIADEKG 210 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 19.8 bits (39), Expect = 8.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 101 EQGPGGAIPSSVIASLVG 118 E+GP PSSVI + G Sbjct: 292 EKGPNSQGPSSVIDTNTG 309 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 19.8 bits (39), Expect = 8.7 Identities = 6/10 (60%), Positives = 8/10 (80%) Query: 86 TVTYVADDKG 95 T Y+ADD+G Sbjct: 202 TTVYIADDRG 211 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 19.8 bits (39), Expect = 8.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Query: 86 TVTYVADDKG 95 T+ Y+AD+KG Sbjct: 201 TMVYIADEKG 210 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 19.8 bits (39), Expect = 8.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Query: 86 TVTYVADDKG 95 T+ Y+AD+KG Sbjct: 201 TMVYIADEKG 210 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 19.8 bits (39), Expect = 8.7 Identities = 5/10 (50%), Positives = 8/10 (80%) Query: 73 GSYSWVAPDG 82 G++SW+ DG Sbjct: 368 GAFSWIGSDG 377 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.136 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,409 Number of Sequences: 429 Number of extensions: 1513 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 118 length of database: 140,377 effective HSP length: 51 effective length of query: 67 effective length of database: 118,498 effective search space: 7939366 effective search space used: 7939366 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.5 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -