BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000342-TA|BGIBMGA000342-PA|IPR000618|Insect cuticle protein, IPR010916|TonB box, N-terminal (125 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132948-3|CAC51075.1| 129|Caenorhabditis elegans Hypothetical ... 28 2.3 Z22177-5|CAA80146.1| 1232|Caenorhabditis elegans Hypothetical pr... 26 6.9 >AL132948-3|CAC51075.1| 129|Caenorhabditis elegans Hypothetical protein Y39B6A.3 protein. Length = 129 Score = 27.9 bits (59), Expect = 2.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 86 GPDGVTYTVTYVADEDGYQPEIEQ 109 G +G+TYT+ Y D+ + E+EQ Sbjct: 56 GCNGLTYTLEYAKDKQKFDEEVEQ 79 >Z22177-5|CAA80146.1| 1232|Caenorhabditis elegans Hypothetical protein ZK512.5 protein. Length = 1232 Score = 26.2 bits (55), Expect = 6.9 Identities = 16/54 (29%), Positives = 24/54 (44%) Query: 30 PREVQILKYENVNSGRGSYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFS 83 PR +Y N +S R + + G+SD T E E + E + + R Q S Sbjct: 157 PRSTAAERYANASSMRNGFVYDSGESDKTSEELEEDEEEEEVRNFYMEGRAQGS 210 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.313 0.135 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,466,402 Number of Sequences: 27539 Number of extensions: 142353 Number of successful extensions: 215 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 213 Number of HSP's gapped (non-prelim): 2 length of query: 125 length of database: 12,573,161 effective HSP length: 73 effective length of query: 52 effective length of database: 10,562,814 effective search space: 549266328 effective search space used: 549266328 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -