BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000342-TA|BGIBMGA000342-PA|IPR000618|Insect cuticle protein, IPR010916|TonB box, N-terminal (125 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 3.5 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 24 8.2 >SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 25.0 bits (52), Expect = 3.5 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 23 IVATAPPPREVQILKYENVNSGRGSYKFGFGQSDG---TRFEQEGALK 67 +++T+PP V ++NS ++ FG +G +RF+ G K Sbjct: 503 VMSTSPPNHSVYPYSQLSINSVTANHGQNFGGQNGGNVSRFDDHGRFK 550 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 23.8 bits (49), Expect = 8.2 Identities = 13/44 (29%), Positives = 20/44 (45%) Query: 13 FKLLALCLVGIVATAPPPREVQILKYENVNSGRGSYKFGFGQSD 56 F+L +LC I P ++ I+K N+G G G +D Sbjct: 870 FELASLCRAVICCRVSPLQKALIVKMVKRNTGEVLLAIGDGAND 913 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.313 0.135 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,990 Number of Sequences: 5004 Number of extensions: 24727 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 30 Number of HSP's gapped (non-prelim): 2 length of query: 125 length of database: 2,362,478 effective HSP length: 65 effective length of query: 60 effective length of database: 2,037,218 effective search space: 122233080 effective search space used: 122233080 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -