BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000342-TA|BGIBMGA000342-PA|IPR000618|Insect cuticle protein, IPR010916|TonB box, N-terminal (125 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 32 0.005 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 30 0.027 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 29 0.063 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 29 0.063 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 29 0.063 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 29 0.063 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 29 0.063 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 29 0.063 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 29 0.063 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 29 0.063 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 29 0.063 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 29 0.063 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 29 0.063 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 28 0.084 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 23 4.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 5.5 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 32.3 bits (70), Expect = 0.005 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 64 GALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQPEIEQGP 111 G K++ + + V+G +S V PDG TV Y AD +G+ + + P Sbjct: 35 GDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRREP 83 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.9 bits (64), Expect = 0.027 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +KN+ + V GQ+S + DG V Y AD G+ Sbjct: 83 NYEFSYSVHD----EHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 106 EIEQGP 111 + P Sbjct: 139 VVRPEP 144 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 91 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 106 EIEQGP 111 + + P Sbjct: 147 VVRREP 152 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 83 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 106 EIEQGP 111 + + P Sbjct: 139 VVRREP 144 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 83 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 106 EIEQGP 111 + + P Sbjct: 139 VVRREP 144 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 83 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 106 EIEQGP 111 + + P Sbjct: 139 VVRREP 144 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 83 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 106 EIEQGP 111 + + P Sbjct: 139 VVRREP 144 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 91 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 106 EIEQGP 111 + + P Sbjct: 147 VVRREP 152 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 115 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 170 Query: 106 EIEQGP 111 + + P Sbjct: 171 VVRREP 176 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 83 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 106 EIEQGP 111 + + P Sbjct: 139 VVRREP 144 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 91 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 106 EIEQGP 111 + + P Sbjct: 147 VVRREP 152 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 83 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 Query: 106 EIEQGP 111 + + P Sbjct: 139 VVRREP 144 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 28.7 bits (61), Expect = 0.063 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 91 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 Query: 106 EIEQGP 111 + + P Sbjct: 147 VVRREP 152 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 28.3 bits (60), Expect = 0.084 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 47 SYKFGFGQSDGTRFEQEGALKNEGQEHESLSVRGQFSWVGPDGVTYTVTYVAD-EDGYQP 105 +Y+F + D E G +K++ + V GQ+S + DG V Y AD G+ Sbjct: 91 NYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNA 146 Query: 106 EIEQGP 111 + + P Sbjct: 147 VVRREP 152 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 12 SFKLLALCLVGIVATAPP 29 SF LA +VG+V++ PP Sbjct: 3 SFVFLASIIVGLVSSQPP 20 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 101 DGYQPEIEQGPGGALPSSI 119 +GY+ I + PGGA+ +++ Sbjct: 1835 EGYRQSIVERPGGAIRATV 1853 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.135 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,695 Number of Sequences: 2123 Number of extensions: 5897 Number of successful extensions: 18 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 16 length of query: 125 length of database: 516,269 effective HSP length: 57 effective length of query: 68 effective length of database: 395,258 effective search space: 26877544 effective search space used: 26877544 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -