BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000340-TA|BGIBMGA000340-PA|IPR000618|Insect cuticle protein (165 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.4 >SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 336 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Query: 93 ELSDGSKHQ--EQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADENGF 143 E+ KHQ + G+ + T+ +A+ + YS +G++Y A ENGF Sbjct: 39 EVEFRGKHQSSKSGKFFDLFTDEKALQRKYTYSADVCEGLSYAAKRFASENGF 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.133 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,743,783 Number of Sequences: 59808 Number of extensions: 169295 Number of successful extensions: 290 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 290 Number of HSP's gapped (non-prelim): 1 length of query: 165 length of database: 16,821,457 effective HSP length: 77 effective length of query: 88 effective length of database: 12,216,241 effective search space: 1075029208 effective search space used: 1075029208 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -