Silkworm BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000340-TA|BGIBMGA000340-PA|IPR000618|Insect cuticle
protein
         (165 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     28   4.4  

>SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 336

 Score = 27.9 bits (59), Expect = 4.4
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 93  ELSDGSKHQ--EQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADENGF 143
           E+    KHQ  + G+  +  T+ +A+  +  YS    +G++Y     A ENGF
Sbjct: 39  EVEFRGKHQSSKSGKFFDLFTDEKALQRKYTYSADVCEGLSYAAKRFASENGF 91


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.133    0.407 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,743,783
Number of Sequences: 59808
Number of extensions: 169295
Number of successful extensions: 290
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 290
Number of HSP's gapped (non-prelim): 1
length of query: 165
length of database: 16,821,457
effective HSP length: 77
effective length of query: 88
effective length of database: 12,216,241
effective search space: 1075029208
effective search space used: 1075029208
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 57 (27.1 bits)