BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000340-TA|BGIBMGA000340-PA|IPR000618|Insect cuticle protein (165 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67460.1 68414.m07681 hypothetical protein contains Pfam doma... 27 6.3 At5g55300.1 68418.m06891 DNA topoisomerase I identical to Swiss-... 27 8.4 >At1g67460.1 68414.m07681 hypothetical protein contains Pfam domain PF03193: Protein of unknown function, DUF258 Length = 434 Score = 27.1 bits (57), Expect = 6.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 84 GLNAYDFAWELSDGSKHQEQGQLKNQGTENE 114 G YD+ +L D K E+ QLK GT+ E Sbjct: 357 GWERYDYFLQLLDEIKIDEECQLKKYGTKRE 387 >At5g55300.1 68418.m06891 DNA topoisomerase I identical to Swiss-Prot:P30181 DNA topoisomerase I [Arabidopsis thaliana] Length = 916 Score = 26.6 bits (56), Expect = 8.4 Identities = 8/41 (19%), Positives = 19/41 (46%) Query: 90 FAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGI 130 + W L + K ++ + + + E + + +Y W DG+ Sbjct: 456 YEWHLEEKEKKKQMSTEEKKALKEEKMKQEEKYMWAVVDGV 496 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.133 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,318,573 Number of Sequences: 28952 Number of extensions: 117475 Number of successful extensions: 234 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 232 Number of HSP's gapped (non-prelim): 2 length of query: 165 length of database: 12,070,560 effective HSP length: 76 effective length of query: 89 effective length of database: 9,870,208 effective search space: 878448512 effective search space used: 878448512 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -