BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000340-TA|BGIBMGA000340-PA|IPR000618|Insect cuticle protein (165 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 36 5e-04 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 33 0.006 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 31 0.024 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 31 0.024 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 31 0.024 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 31 0.024 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 31 0.024 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 31 0.024 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 31 0.024 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 31 0.024 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 31 0.024 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 31 0.024 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 31 0.024 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 30 0.032 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 24 2.8 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 36.3 bits (80), Expect = 5e-04 Identities = 20/41 (48%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 104 GQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIAD-ENGF 143 G K+Q + VQG YS V PDG TV Y AD NGF Sbjct: 35 GDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 75 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 32.7 bits (71), Expect = 0.006 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +KNQ V GQYS + DG V Y AD + GF Sbjct: 84 YEFSYSVHD----EHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 92 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 84 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 84 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 84 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 84 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 92 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 116 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 168 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 84 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 92 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 84 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 30.7 bits (66), Expect = 0.024 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 92 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 30.3 bits (65), Expect = 0.032 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 88 YDFAWELSDGSKHQEQGQLKNQGTENEAISVQGQYSWVAPDGITYTVTYIADEN-GF 143 Y+F++ + D + G +K+Q V GQYS + DG V Y AD + GF Sbjct: 92 YEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGF 144 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 23.8 bits (49), Expect = 2.8 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Query: 12 QLCVRTATFTRVYRD----RCCVLR--SIAGSNGVL 41 Q CVRT TF R RC VLR A S GVL Sbjct: 172 QTCVRTETFLRQGNGAALLRCVVLRLGLYADSTGVL 207 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.133 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,930 Number of Sequences: 2123 Number of extensions: 5439 Number of successful extensions: 17 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 15 length of query: 165 length of database: 516,269 effective HSP length: 59 effective length of query: 106 effective length of database: 391,012 effective search space: 41447272 effective search space used: 41447272 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -