GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000338-TA|BGIBMGA000338-PA|IPR000618|Insect cuticle
protein, IPR000437|Prokaryotic membrane lipoprotein lipid attachment
site
         (154 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   4.7  

>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein
            protein.
          Length = 1156

 Score = 21.0 bits (42), Expect = 4.7
 Identities = 12/53 (22%), Positives = 24/53 (45%)

Query: 64   YLKNAGAKDAEAQVAQGSFTYTSPEGIPISVSYVADENGFRPEGAHLPTPPPI 116
            ++K+    D  A  +    + +S EG+P+  + V   +G    G+     PP+
Sbjct: 1078 FVKDGVIPDPVALKSAQQGSSSSSEGVPLKGTAVPPPSGSSGPGSTGSKSPPV 1130


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,785
Number of Sequences: 317
Number of extensions: 1160
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 154
length of database: 114,650
effective HSP length: 52
effective length of query: 102
effective length of database: 98,166
effective search space: 10012932
effective search space used: 10012932
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.1 bits)
S2: 40 (20.2 bits)